Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A139HLY1

Protein Details
Accession A0A139HLY1    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
93-112EDTPKPKKGNVKQEKTEDEDAcidic
NLS Segment(s)
PositionSequence
69-85KGHMPETPKVKGGKKRK
Subcellular Location(s) nucl 12, cyto_nucl 9.833, mito_nucl 9.333, cyto 6.5, mito 5.5
Family & Domain DBs
Amino Acid Sequences MGRPKGVIGMKWDDTRERELLLSIIQQLQPSPSGLDWAAIVNIMGGDASEAACKLKFSKLKKAADEVGKGHMPETPKVKGGKKRKTEAEDDEEDTPKPKKGNVKQEKTEDEDEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.39
3 0.35
4 0.29
5 0.25
6 0.23
7 0.22
8 0.18
9 0.16
10 0.13
11 0.15
12 0.14
13 0.14
14 0.13
15 0.14
16 0.13
17 0.13
18 0.12
19 0.09
20 0.1
21 0.1
22 0.1
23 0.09
24 0.09
25 0.08
26 0.06
27 0.06
28 0.04
29 0.04
30 0.03
31 0.03
32 0.02
33 0.02
34 0.02
35 0.03
36 0.03
37 0.03
38 0.04
39 0.04
40 0.05
41 0.06
42 0.11
43 0.17
44 0.21
45 0.31
46 0.39
47 0.44
48 0.45
49 0.48
50 0.48
51 0.47
52 0.46
53 0.36
54 0.32
55 0.28
56 0.26
57 0.22
58 0.19
59 0.17
60 0.17
61 0.21
62 0.19
63 0.22
64 0.27
65 0.33
66 0.41
67 0.5
68 0.57
69 0.61
70 0.67
71 0.71
72 0.72
73 0.73
74 0.71
75 0.67
76 0.62
77 0.56
78 0.52
79 0.44
80 0.39
81 0.35
82 0.3
83 0.26
84 0.23
85 0.25
86 0.32
87 0.4
88 0.51
89 0.59
90 0.67
91 0.72
92 0.79
93 0.81
94 0.77