Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A139HF48

Protein Details
Accession A0A139HF48    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
5-24IEDALKKRKGKQPDGKIADGBasic
NLS Segment(s)
PositionSequence
12-13RK
Subcellular Location(s) nucl 18.5, cyto_nucl 11, mito 3, pero 3
Family & Domain DBs
Amino Acid Sequences MMDQIEDALKKRKGKQPDGKIADGDEDHAKRPMMLQDFRLRNGPAWARNVNLDKTRQDFYKICVKIDEKAIEYDSKRANLDILLAAARLAEP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.72
3 0.74
4 0.8
5 0.8
6 0.74
7 0.68
8 0.58
9 0.5
10 0.39
11 0.31
12 0.26
13 0.2
14 0.2
15 0.2
16 0.2
17 0.17
18 0.18
19 0.21
20 0.21
21 0.21
22 0.24
23 0.31
24 0.33
25 0.34
26 0.35
27 0.31
28 0.26
29 0.28
30 0.28
31 0.22
32 0.25
33 0.24
34 0.22
35 0.25
36 0.27
37 0.25
38 0.25
39 0.25
40 0.23
41 0.25
42 0.27
43 0.24
44 0.27
45 0.25
46 0.26
47 0.33
48 0.31
49 0.28
50 0.31
51 0.32
52 0.29
53 0.35
54 0.34
55 0.26
56 0.27
57 0.29
58 0.29
59 0.29
60 0.32
61 0.29
62 0.29
63 0.28
64 0.26
65 0.25
66 0.2
67 0.21
68 0.16
69 0.14
70 0.11
71 0.11
72 0.1