Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E5A3N2

Protein Details
Accession E5A3N2    Localization Confidence Low Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
55-74LFPREVSWRRVKKRPCGGGAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, nucl 4, cyto 1.5, cyto_pero 1.5
Family & Domain DBs
Amino Acid Sequences MCTKVTLRHISCKHDFWIRRNCHRHPTCDFQTYVTRERGGECWDCDPGQGPPEALFPREVSWRRVKKRPCGGGAVSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.54
3 0.52
4 0.58
5 0.58
6 0.64
7 0.69
8 0.69
9 0.71
10 0.7
11 0.69
12 0.65
13 0.65
14 0.6
15 0.57
16 0.52
17 0.44
18 0.46
19 0.44
20 0.42
21 0.34
22 0.3
23 0.25
24 0.26
25 0.24
26 0.22
27 0.19
28 0.17
29 0.16
30 0.17
31 0.17
32 0.16
33 0.15
34 0.13
35 0.12
36 0.11
37 0.1
38 0.09
39 0.14
40 0.15
41 0.14
42 0.14
43 0.14
44 0.15
45 0.24
46 0.25
47 0.27
48 0.37
49 0.46
50 0.53
51 0.61
52 0.67
53 0.7
54 0.78
55 0.81
56 0.75
57 0.73