Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139HPB8

Protein Details
Accession A0A139HPB8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
105-135CQTWRIKYKAAPKPKPKPKPAAPKKTNWLGQHydrophilic
NLS Segment(s)
PositionSequence
111-129KYKAAPKPKPKPKPAAPKK
Subcellular Location(s) extr 18, mito 4, plas 2, golg 2, cyto_mito 2, mito_nucl 2
Family & Domain DBs
Amino Acid Sequences MRILAFLTLLIGAILVSADDSSTCRSKHPIAWQAINRFCAITNMQVPSGYAKQGYSTGGASVWIDGSVLNACRPAQWVPKLYCHKQFYSMCAQSKDHAFYGKANCQTWRIKYKAAPKPKPKPKPAAPKKTNWLGQPGLSNPFYTKRHAEAMPEATEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.03
3 0.03
4 0.03
5 0.03
6 0.04
7 0.05
8 0.09
9 0.13
10 0.14
11 0.16
12 0.21
13 0.25
14 0.31
15 0.39
16 0.44
17 0.46
18 0.54
19 0.58
20 0.62
21 0.62
22 0.57
23 0.48
24 0.39
25 0.33
26 0.28
27 0.23
28 0.19
29 0.19
30 0.19
31 0.19
32 0.18
33 0.19
34 0.19
35 0.19
36 0.16
37 0.13
38 0.11
39 0.12
40 0.13
41 0.13
42 0.1
43 0.1
44 0.09
45 0.08
46 0.09
47 0.08
48 0.07
49 0.06
50 0.05
51 0.04
52 0.04
53 0.04
54 0.05
55 0.05
56 0.05
57 0.06
58 0.06
59 0.06
60 0.09
61 0.1
62 0.15
63 0.18
64 0.23
65 0.24
66 0.33
67 0.39
68 0.4
69 0.46
70 0.44
71 0.42
72 0.44
73 0.43
74 0.39
75 0.42
76 0.44
77 0.38
78 0.38
79 0.38
80 0.32
81 0.34
82 0.32
83 0.24
84 0.21
85 0.19
86 0.21
87 0.26
88 0.29
89 0.31
90 0.29
91 0.3
92 0.33
93 0.37
94 0.39
95 0.4
96 0.37
97 0.38
98 0.43
99 0.52
100 0.56
101 0.63
102 0.66
103 0.69
104 0.77
105 0.84
106 0.88
107 0.86
108 0.87
109 0.86
110 0.87
111 0.88
112 0.88
113 0.84
114 0.82
115 0.82
116 0.81
117 0.76
118 0.67
119 0.63
120 0.54
121 0.5
122 0.46
123 0.41
124 0.37
125 0.33
126 0.31
127 0.27
128 0.32
129 0.31
130 0.32
131 0.33
132 0.32
133 0.37
134 0.38
135 0.4
136 0.4
137 0.43