Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139H5Z9

Protein Details
Accession A0A139H5Z9    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
97-126QANKIEKASRQQRKQRKNRSKEFRGTAKTKHydrophilic
NLS Segment(s)
PositionSequence
102-134EKASRQQRKQRKNRSKEFRGTAKTKGPGKDKKK
Subcellular Location(s) mito 18, cyto_nucl 5, nucl 4.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MSESQVTLRTRKFIRNPLLGRKQMVVDVLHPNRANVSKDELREKLAGLYKTNKDQVSVFGFRTQFGGGKSTGFALLYDSPEAIKKFEPHYRLVRYGQANKIEKASRQQRKQRKNRSKEFRGTAKTKGPGKDKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.64
3 0.68
4 0.72
5 0.78
6 0.72
7 0.66
8 0.59
9 0.51
10 0.42
11 0.38
12 0.29
13 0.22
14 0.29
15 0.28
16 0.32
17 0.3
18 0.29
19 0.3
20 0.32
21 0.31
22 0.23
23 0.29
24 0.27
25 0.3
26 0.36
27 0.33
28 0.33
29 0.31
30 0.3
31 0.27
32 0.28
33 0.26
34 0.23
35 0.29
36 0.28
37 0.32
38 0.36
39 0.31
40 0.27
41 0.26
42 0.27
43 0.27
44 0.26
45 0.23
46 0.22
47 0.22
48 0.21
49 0.22
50 0.19
51 0.14
52 0.13
53 0.14
54 0.1
55 0.1
56 0.1
57 0.09
58 0.09
59 0.07
60 0.07
61 0.07
62 0.08
63 0.09
64 0.09
65 0.08
66 0.08
67 0.11
68 0.11
69 0.1
70 0.11
71 0.13
72 0.17
73 0.22
74 0.25
75 0.28
76 0.35
77 0.38
78 0.41
79 0.41
80 0.43
81 0.44
82 0.48
83 0.48
84 0.5
85 0.49
86 0.45
87 0.48
88 0.44
89 0.4
90 0.43
91 0.48
92 0.49
93 0.56
94 0.65
95 0.71
96 0.8
97 0.89
98 0.9
99 0.91
100 0.92
101 0.93
102 0.93
103 0.93
104 0.92
105 0.89
106 0.88
107 0.86
108 0.79
109 0.75
110 0.73
111 0.71
112 0.67
113 0.66
114 0.66