Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E5A9E5

Protein Details
Accession E5A9E5    Localization Confidence Low Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
39-58IRRCSFKVPKFGRRNCRFRGHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 9.666, cyto 9, mito_nucl 7.999, mito 7.5, nucl 7, cyto_pero 5.999
Family & Domain DBs
Amino Acid Sequences MTDLEVHPYPHRPLSGKHDPGLWSPTWSRNWIDTKILTIRRCSFKVPKFGRRNCRFRGWMSDPNRKGMQNANG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.47
3 0.46
4 0.44
5 0.44
6 0.42
7 0.42
8 0.42
9 0.33
10 0.26
11 0.24
12 0.28
13 0.27
14 0.28
15 0.26
16 0.28
17 0.31
18 0.3
19 0.3
20 0.25
21 0.26
22 0.29
23 0.33
24 0.28
25 0.28
26 0.31
27 0.34
28 0.35
29 0.37
30 0.4
31 0.4
32 0.5
33 0.53
34 0.59
35 0.64
36 0.72
37 0.78
38 0.79
39 0.82
40 0.77
41 0.78
42 0.72
43 0.65
44 0.67
45 0.63
46 0.63
47 0.63
48 0.69
49 0.61
50 0.64
51 0.64
52 0.55
53 0.5