Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A139HBS6

Protein Details
Accession A0A139HBS6    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
34-63QKPPPTTPTRAPKHKKKAKRAPRTGSFKRIBasic
NLS Segment(s)
PositionSequence
17-60AKPPPPPEKAKSYVGASQKPPPTTPTRAPKHKKKAKRAPRTGSF
Subcellular Location(s) nucl 11.5, mito_nucl 10, cyto 8, mito 7.5
Family & Domain DBs
Amino Acid Sequences MTPKTPTRRQPGTSSPAKPPPPPEKAKSYVGASQKPPPTTPTRAPKHKKKAKRAPRTGSFKRINLDASKNAELQRFIKIREAMRCPLTRSGVDMFEEGHFWLFELP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.64
3 0.64
4 0.64
5 0.59
6 0.59
7 0.6
8 0.6
9 0.62
10 0.6
11 0.58
12 0.59
13 0.6
14 0.55
15 0.49
16 0.47
17 0.46
18 0.46
19 0.41
20 0.44
21 0.44
22 0.42
23 0.39
24 0.38
25 0.38
26 0.38
27 0.43
28 0.46
29 0.5
30 0.59
31 0.67
32 0.73
33 0.78
34 0.81
35 0.83
36 0.84
37 0.86
38 0.87
39 0.89
40 0.89
41 0.86
42 0.86
43 0.87
44 0.81
45 0.79
46 0.73
47 0.64
48 0.56
49 0.49
50 0.42
51 0.36
52 0.35
53 0.3
54 0.3
55 0.3
56 0.3
57 0.31
58 0.29
59 0.28
60 0.25
61 0.28
62 0.25
63 0.24
64 0.29
65 0.31
66 0.34
67 0.4
68 0.43
69 0.4
70 0.45
71 0.46
72 0.43
73 0.45
74 0.44
75 0.37
76 0.36
77 0.34
78 0.3
79 0.29
80 0.25
81 0.21
82 0.18
83 0.19
84 0.15
85 0.14
86 0.11