Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E4ZNL7

Protein Details
Accession E4ZNL7    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
108-127PSPFDHSRRERKTRVTESGTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12mito 12mito_nucl 12
Family & Domain DBs
Amino Acid Sequences MPRMTSDREAASKMLRFVGRCIVNQIIITSAEIGISNSVPKYERRKQLAPSCAVKANIRHDPLWSDKVPNSKRADSTAYRPNNFSAPLNPPLQDIDQASSWQVSQFVPSPFDHSRRERKTRVTESGT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.29
3 0.28
4 0.28
5 0.34
6 0.32
7 0.3
8 0.33
9 0.29
10 0.28
11 0.27
12 0.25
13 0.18
14 0.15
15 0.15
16 0.11
17 0.09
18 0.08
19 0.07
20 0.07
21 0.07
22 0.06
23 0.07
24 0.06
25 0.08
26 0.09
27 0.14
28 0.22
29 0.3
30 0.38
31 0.44
32 0.49
33 0.56
34 0.63
35 0.65
36 0.62
37 0.57
38 0.51
39 0.47
40 0.44
41 0.38
42 0.33
43 0.32
44 0.32
45 0.3
46 0.28
47 0.26
48 0.27
49 0.28
50 0.29
51 0.24
52 0.21
53 0.2
54 0.3
55 0.31
56 0.35
57 0.36
58 0.34
59 0.35
60 0.35
61 0.39
62 0.32
63 0.36
64 0.38
65 0.39
66 0.38
67 0.38
68 0.37
69 0.33
70 0.33
71 0.28
72 0.23
73 0.22
74 0.24
75 0.25
76 0.24
77 0.22
78 0.23
79 0.23
80 0.21
81 0.17
82 0.16
83 0.15
84 0.15
85 0.15
86 0.13
87 0.13
88 0.11
89 0.11
90 0.09
91 0.11
92 0.15
93 0.16
94 0.18
95 0.19
96 0.25
97 0.29
98 0.34
99 0.38
100 0.42
101 0.51
102 0.58
103 0.67
104 0.67
105 0.73
106 0.78
107 0.8