Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A139HGH0

Protein Details
Accession A0A139HGH0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
45-66YETPDGRTVRRRKKRCVQDGADHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 12, golg 5, mito 3, E.R. 3, plas 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MHYLHPRSRTTGTLFTTTLAISFAVVALPHLLPCPVDRRQFADSYETPDGRTVRRRKKRCVQDGADANENVESIPDALADTRPQRECPLPKPGGIVGQIMGFTKDERQKPTEVIVQSLQNKRQRSLPSDSSDTP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.34
3 0.32
4 0.27
5 0.22
6 0.15
7 0.11
8 0.07
9 0.07
10 0.06
11 0.05
12 0.05
13 0.05
14 0.06
15 0.06
16 0.06
17 0.07
18 0.07
19 0.07
20 0.09
21 0.14
22 0.18
23 0.23
24 0.24
25 0.28
26 0.32
27 0.33
28 0.33
29 0.35
30 0.3
31 0.32
32 0.35
33 0.3
34 0.27
35 0.29
36 0.29
37 0.25
38 0.33
39 0.36
40 0.43
41 0.53
42 0.6
43 0.66
44 0.75
45 0.82
46 0.83
47 0.83
48 0.76
49 0.74
50 0.73
51 0.67
52 0.6
53 0.49
54 0.39
55 0.3
56 0.25
57 0.16
58 0.1
59 0.06
60 0.03
61 0.04
62 0.03
63 0.03
64 0.04
65 0.05
66 0.07
67 0.09
68 0.13
69 0.15
70 0.16
71 0.19
72 0.25
73 0.3
74 0.32
75 0.4
76 0.37
77 0.36
78 0.38
79 0.36
80 0.32
81 0.28
82 0.24
83 0.15
84 0.14
85 0.14
86 0.12
87 0.12
88 0.09
89 0.08
90 0.14
91 0.21
92 0.24
93 0.29
94 0.32
95 0.34
96 0.36
97 0.4
98 0.4
99 0.34
100 0.33
101 0.31
102 0.35
103 0.4
104 0.45
105 0.48
106 0.48
107 0.5
108 0.48
109 0.53
110 0.53
111 0.51
112 0.53
113 0.54
114 0.54