Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E5AD93

Protein Details
Accession E5AD93    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MDGKLLKKARSKKQEGKKGWSGPBasic
NLS Segment(s)
PositionSequence
7-19KKARSKKQEGKKG
Subcellular Location(s) mito 13, nucl 9, cyto 4
Family & Domain DBs
Amino Acid Sequences MDGKLLKKARSKKQEGKKGWSGPATAPNEGMSEFPKSWLAGCYGQRKKRGLFAARCFGGCRETHNTHRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.85
3 0.84
4 0.82
5 0.77
6 0.72
7 0.64
8 0.55
9 0.47
10 0.48
11 0.43
12 0.34
13 0.29
14 0.24
15 0.22
16 0.2
17 0.19
18 0.11
19 0.11
20 0.11
21 0.11
22 0.11
23 0.11
24 0.11
25 0.11
26 0.13
27 0.14
28 0.19
29 0.29
30 0.37
31 0.42
32 0.48
33 0.51
34 0.49
35 0.52
36 0.56
37 0.55
38 0.56
39 0.58
40 0.61
41 0.58
42 0.58
43 0.52
44 0.45
45 0.4
46 0.31
47 0.3
48 0.3
49 0.35