Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E5ABK0

Protein Details
Accession E5ABK0   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MGKRKSSSKPQGPKKKEKLPTIFQCLFHydrophilic
NLS Segment(s)
PositionSequence
3-18KRKSSSKPQGPKKKEK
Subcellular Location(s) mito 10, mito_nucl 9.833, cyto_mito 9.333, nucl 8.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKSSSKPQGPKKKEKLPTIFQCLFCNHEKSVSVSIEKKSGVGNLQCKVCGQTFQTNINYLSAPVDVYADWMDACDAVAKEAARGNATTERSTNRSGALPKMTDVDEDGFIEQDDVDAEGEYAD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.9
3 0.88
4 0.88
5 0.85
6 0.84
7 0.83
8 0.81
9 0.77
10 0.69
11 0.63
12 0.55
13 0.51
14 0.44
15 0.39
16 0.3
17 0.27
18 0.26
19 0.26
20 0.29
21 0.27
22 0.27
23 0.26
24 0.27
25 0.27
26 0.26
27 0.23
28 0.18
29 0.18
30 0.19
31 0.2
32 0.23
33 0.24
34 0.25
35 0.24
36 0.24
37 0.24
38 0.21
39 0.18
40 0.17
41 0.2
42 0.22
43 0.26
44 0.27
45 0.26
46 0.26
47 0.25
48 0.21
49 0.15
50 0.13
51 0.09
52 0.08
53 0.06
54 0.06
55 0.05
56 0.06
57 0.06
58 0.05
59 0.05
60 0.05
61 0.05
62 0.04
63 0.04
64 0.05
65 0.05
66 0.05
67 0.07
68 0.07
69 0.08
70 0.1
71 0.11
72 0.1
73 0.1
74 0.13
75 0.17
76 0.2
77 0.2
78 0.2
79 0.23
80 0.26
81 0.28
82 0.26
83 0.22
84 0.24
85 0.26
86 0.28
87 0.29
88 0.27
89 0.25
90 0.27
91 0.26
92 0.22
93 0.22
94 0.19
95 0.15
96 0.16
97 0.15
98 0.13
99 0.12
100 0.12
101 0.1
102 0.07
103 0.07
104 0.06
105 0.07
106 0.06