Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E5A9T3

Protein Details
Accession E5A9T3    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
133-158VVATNKNKKAKAPRKNGKQTNTHMAHHydrophilic
NLS Segment(s)
PositionSequence
138-149KNKKAKAPRKNG
Subcellular Location(s) mito 11, nucl 8.5, cyto_nucl 7, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR040501  TFA2_Winged_2  
IPR016656  TFIIE-bsu  
Gene Ontology GO:0005673  C:transcription factor TFIIE complex  
GO:0006367  P:transcription initiation at RNA polymerase II promoter  
Pfam View protein in Pfam  
PF18121  TFA2_Winged_2  
Amino Acid Sequences MRADNAGNRISWNSANETYRYKPKLQIRNAAQLKGYLQSQKSAMGLSIKDLKDGWATVADDIKLMEDKNEVLVKRTKDGVARTVWNNDPSMMHPMEPEFAQMWHRIAIPANPDELRSALQGAGLVAATQKKEVVATNKNKKAKAPRKNGKQTNTHMAHLLKDFSGMRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.3
3 0.31
4 0.35
5 0.37
6 0.44
7 0.46
8 0.43
9 0.47
10 0.54
11 0.61
12 0.63
13 0.68
14 0.64
15 0.71
16 0.71
17 0.64
18 0.55
19 0.47
20 0.41
21 0.33
22 0.3
23 0.24
24 0.21
25 0.22
26 0.22
27 0.22
28 0.21
29 0.18
30 0.17
31 0.14
32 0.14
33 0.14
34 0.21
35 0.19
36 0.2
37 0.19
38 0.19
39 0.18
40 0.18
41 0.16
42 0.11
43 0.12
44 0.12
45 0.13
46 0.12
47 0.11
48 0.1
49 0.1
50 0.08
51 0.07
52 0.07
53 0.06
54 0.06
55 0.09
56 0.12
57 0.11
58 0.14
59 0.18
60 0.19
61 0.2
62 0.22
63 0.2
64 0.21
65 0.22
66 0.23
67 0.21
68 0.23
69 0.22
70 0.24
71 0.25
72 0.23
73 0.21
74 0.18
75 0.16
76 0.14
77 0.18
78 0.14
79 0.13
80 0.12
81 0.12
82 0.12
83 0.11
84 0.11
85 0.07
86 0.08
87 0.09
88 0.1
89 0.1
90 0.1
91 0.11
92 0.1
93 0.11
94 0.12
95 0.14
96 0.14
97 0.15
98 0.15
99 0.15
100 0.15
101 0.15
102 0.14
103 0.11
104 0.11
105 0.09
106 0.09
107 0.08
108 0.08
109 0.07
110 0.06
111 0.05
112 0.06
113 0.07
114 0.07
115 0.08
116 0.08
117 0.08
118 0.09
119 0.13
120 0.19
121 0.27
122 0.37
123 0.48
124 0.56
125 0.61
126 0.62
127 0.66
128 0.7
129 0.71
130 0.71
131 0.72
132 0.74
133 0.8
134 0.9
135 0.91
136 0.88
137 0.87
138 0.84
139 0.83
140 0.76
141 0.67
142 0.61
143 0.53
144 0.49
145 0.42
146 0.37
147 0.26
148 0.25