Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139HYM5

Protein Details
Accession A0A139HYM5   
Localization Confidence High
Confidence Score 15.1
NoLS Segment(s)
PositionSequenceProtein Nature
101-140HTVYKRREPIRRDSQKRREALQKGKEGSRRRQRWENDRLLBasic
267-286MSDARKREKQHKHLEKDKLIBasic
429-452RENWWTSPEKRTQRQRFELEDPKKHydrophilic
NLS Segment(s)
PositionSequence
105-133KRREPIRRDSQKRREALQKGKEGSRRRQR
Subcellular Location(s) mito 16.5, cyto_mito 10.5, nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR025952  R3H-assoc_dom  
IPR036867  R3H_dom_sf  
IPR039629  R3HDM4  
Gene Ontology GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF13902  R3H-assoc  
CDD cd02325  R3H  
Amino Acid Sequences MCSSPSPPTKQSWPLASRNIAVPYRIMAIHPETDNARVELPPPATSIERVEAWTVSQAADVLAATSLSPRAARGTSVTIDIPLDEQVLSEEPPRPRPEAVHTVYKRREPIRRDSQKRREALQKGKEGSRRRQRWENDRLLSNPHAEPPLPSDWQVQPTHPVHRVPYFLAPLWDAEYARQQQERQKRVQASKQYASKEEAAAAKVTQELRAKLKKSRGAKGLLQDLEEEVRGFVQQWEEKQRELESEGVIEPDSSDEEIVFVGRNGAMSDARKREKQHKHLEKDKLIFQGLVDDHGAAFGRYLVHSIAAYYGLKTYSITTGNPARREAYVGLKIDPKTRRPSLARAEMPRPLWTVQSCGFTMCQLCGIKNGLARWPKAVEIMKPGLELLVESAHEEHEAWKKAGASEPSESLLEVCRLLLTMVESIEEERENWWTSPEKRTQRQRFELEDPKKFTELHKINNALTGDVEAMRTRLGSYARWTLDMRGGLADIE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.65
3 0.63
4 0.58
5 0.54
6 0.55
7 0.46
8 0.4
9 0.34
10 0.28
11 0.27
12 0.25
13 0.21
14 0.18
15 0.21
16 0.24
17 0.24
18 0.25
19 0.24
20 0.26
21 0.28
22 0.25
23 0.23
24 0.19
25 0.19
26 0.23
27 0.23
28 0.21
29 0.2
30 0.22
31 0.22
32 0.23
33 0.25
34 0.22
35 0.21
36 0.22
37 0.22
38 0.19
39 0.18
40 0.19
41 0.17
42 0.14
43 0.13
44 0.11
45 0.1
46 0.1
47 0.08
48 0.06
49 0.06
50 0.05
51 0.05
52 0.06
53 0.07
54 0.07
55 0.08
56 0.08
57 0.11
58 0.12
59 0.13
60 0.15
61 0.19
62 0.19
63 0.21
64 0.21
65 0.18
66 0.18
67 0.17
68 0.15
69 0.11
70 0.1
71 0.08
72 0.07
73 0.08
74 0.09
75 0.1
76 0.12
77 0.17
78 0.19
79 0.26
80 0.29
81 0.31
82 0.31
83 0.33
84 0.39
85 0.42
86 0.44
87 0.48
88 0.49
89 0.55
90 0.59
91 0.61
92 0.6
93 0.57
94 0.61
95 0.55
96 0.62
97 0.64
98 0.7
99 0.76
100 0.8
101 0.84
102 0.84
103 0.82
104 0.78
105 0.76
106 0.74
107 0.74
108 0.72
109 0.69
110 0.65
111 0.68
112 0.7
113 0.68
114 0.69
115 0.7
116 0.7
117 0.69
118 0.74
119 0.75
120 0.78
121 0.81
122 0.8
123 0.74
124 0.7
125 0.64
126 0.6
127 0.54
128 0.47
129 0.38
130 0.3
131 0.26
132 0.22
133 0.22
134 0.21
135 0.23
136 0.2
137 0.21
138 0.23
139 0.23
140 0.29
141 0.29
142 0.25
143 0.29
144 0.3
145 0.35
146 0.34
147 0.33
148 0.31
149 0.32
150 0.33
151 0.28
152 0.29
153 0.26
154 0.23
155 0.22
156 0.19
157 0.17
158 0.17
159 0.16
160 0.12
161 0.11
162 0.16
163 0.18
164 0.2
165 0.22
166 0.22
167 0.29
168 0.39
169 0.44
170 0.43
171 0.48
172 0.53
173 0.57
174 0.62
175 0.64
176 0.62
177 0.62
178 0.63
179 0.58
180 0.52
181 0.49
182 0.43
183 0.34
184 0.29
185 0.24
186 0.19
187 0.17
188 0.15
189 0.12
190 0.13
191 0.13
192 0.14
193 0.15
194 0.17
195 0.23
196 0.28
197 0.3
198 0.33
199 0.4
200 0.43
201 0.46
202 0.51
203 0.5
204 0.49
205 0.5
206 0.49
207 0.49
208 0.42
209 0.37
210 0.3
211 0.25
212 0.21
213 0.18
214 0.13
215 0.06
216 0.06
217 0.05
218 0.05
219 0.06
220 0.08
221 0.09
222 0.12
223 0.19
224 0.2
225 0.2
226 0.21
227 0.21
228 0.19
229 0.19
230 0.18
231 0.11
232 0.11
233 0.11
234 0.1
235 0.09
236 0.08
237 0.06
238 0.05
239 0.06
240 0.04
241 0.04
242 0.04
243 0.04
244 0.04
245 0.04
246 0.04
247 0.03
248 0.04
249 0.04
250 0.04
251 0.04
252 0.05
253 0.06
254 0.08
255 0.13
256 0.19
257 0.22
258 0.25
259 0.29
260 0.38
261 0.47
262 0.55
263 0.62
264 0.66
265 0.72
266 0.77
267 0.82
268 0.78
269 0.72
270 0.66
271 0.57
272 0.48
273 0.39
274 0.3
275 0.27
276 0.2
277 0.18
278 0.14
279 0.11
280 0.1
281 0.11
282 0.11
283 0.05
284 0.05
285 0.04
286 0.05
287 0.05
288 0.06
289 0.06
290 0.06
291 0.06
292 0.06
293 0.06
294 0.07
295 0.07
296 0.07
297 0.07
298 0.07
299 0.07
300 0.08
301 0.08
302 0.1
303 0.11
304 0.11
305 0.14
306 0.21
307 0.26
308 0.27
309 0.28
310 0.27
311 0.25
312 0.28
313 0.26
314 0.25
315 0.26
316 0.25
317 0.26
318 0.29
319 0.3
320 0.34
321 0.37
322 0.36
323 0.39
324 0.41
325 0.46
326 0.45
327 0.52
328 0.54
329 0.59
330 0.6
331 0.57
332 0.58
333 0.56
334 0.53
335 0.47
336 0.41
337 0.32
338 0.29
339 0.24
340 0.25
341 0.23
342 0.24
343 0.22
344 0.21
345 0.2
346 0.18
347 0.18
348 0.14
349 0.17
350 0.14
351 0.15
352 0.16
353 0.18
354 0.19
355 0.21
356 0.22
357 0.24
358 0.28
359 0.28
360 0.29
361 0.28
362 0.26
363 0.3
364 0.31
365 0.27
366 0.28
367 0.31
368 0.28
369 0.27
370 0.26
371 0.2
372 0.17
373 0.15
374 0.09
375 0.07
376 0.07
377 0.07
378 0.08
379 0.08
380 0.09
381 0.09
382 0.12
383 0.18
384 0.21
385 0.21
386 0.23
387 0.24
388 0.25
389 0.31
390 0.3
391 0.27
392 0.26
393 0.27
394 0.27
395 0.26
396 0.24
397 0.19
398 0.18
399 0.15
400 0.12
401 0.11
402 0.09
403 0.09
404 0.09
405 0.09
406 0.08
407 0.08
408 0.08
409 0.09
410 0.09
411 0.1
412 0.12
413 0.11
414 0.1
415 0.1
416 0.13
417 0.16
418 0.16
419 0.18
420 0.24
421 0.28
422 0.36
423 0.44
424 0.51
425 0.58
426 0.69
427 0.76
428 0.8
429 0.85
430 0.84
431 0.81
432 0.8
433 0.81
434 0.79
435 0.78
436 0.73
437 0.68
438 0.62
439 0.56
440 0.5
441 0.5
442 0.48
443 0.47
444 0.5
445 0.51
446 0.49
447 0.54
448 0.52
449 0.41
450 0.35
451 0.27
452 0.2
453 0.16
454 0.17
455 0.12
456 0.12
457 0.12
458 0.11
459 0.11
460 0.13
461 0.15
462 0.17
463 0.22
464 0.3
465 0.31
466 0.34
467 0.35
468 0.34
469 0.38
470 0.36
471 0.32
472 0.24