Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E5ACL8

Protein Details
Accession E5ACL8    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
79-124ASESTPRKKATPRKRKGKVEDADNAGGSPKKRGRPKKIVTPKDEADBasic
NLS Segment(s)
PositionSequence
84-115PRKKATPRKRKGKVEDADNAGGSPKKRGRPKK
Subcellular Location(s) cyto 16.5, cyto_nucl 14, nucl 10.5
Family & Domain DBs
Amino Acid Sequences MADNTPKAPGAGWTEHEVLVYILSGMEHSKFKIDYSNAPIPVGRSADGIRQKINKLVLALKPEMDALKGGQSLPTTTTASESTPRKKATPRKRKGKVEDADNAGGSPKKRGRPKKIVTPKDEADDEDINVKEEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.27
3 0.27
4 0.23
5 0.17
6 0.14
7 0.11
8 0.07
9 0.05
10 0.05
11 0.05
12 0.06
13 0.07
14 0.08
15 0.09
16 0.11
17 0.11
18 0.12
19 0.18
20 0.2
21 0.23
22 0.3
23 0.36
24 0.34
25 0.34
26 0.34
27 0.29
28 0.29
29 0.25
30 0.17
31 0.13
32 0.13
33 0.19
34 0.24
35 0.24
36 0.25
37 0.27
38 0.27
39 0.29
40 0.3
41 0.25
42 0.21
43 0.24
44 0.23
45 0.24
46 0.23
47 0.2
48 0.18
49 0.17
50 0.16
51 0.12
52 0.1
53 0.06
54 0.07
55 0.07
56 0.07
57 0.07
58 0.07
59 0.07
60 0.08
61 0.1
62 0.1
63 0.09
64 0.11
65 0.11
66 0.12
67 0.17
68 0.21
69 0.24
70 0.29
71 0.31
72 0.32
73 0.4
74 0.49
75 0.55
76 0.62
77 0.67
78 0.73
79 0.81
80 0.88
81 0.88
82 0.88
83 0.83
84 0.78
85 0.75
86 0.69
87 0.61
88 0.51
89 0.43
90 0.34
91 0.31
92 0.24
93 0.25
94 0.26
95 0.32
96 0.42
97 0.53
98 0.62
99 0.7
100 0.78
101 0.81
102 0.87
103 0.88
104 0.85
105 0.82
106 0.75
107 0.7
108 0.63
109 0.53
110 0.48
111 0.4
112 0.34
113 0.31
114 0.28