Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139HYA4

Protein Details
Accession A0A139HYA4    Localization Confidence High Confidence Score 16.6
NoLS Segment(s)
PositionSequenceProtein Nature
142-161DRPSGDRPPRPPRPPRGPASBasic
199-239RTESEEQRRRERRKEREERHKQEKEKIRRGEKKPRKPQGLDBasic
NLS Segment(s)
PositionSequence
135-188PPSYRAPDRPSGDRPPRPPRPPRGPASPDKNGFSRPRPRRASESSVMEKERRPR
205-235QRRRERRKEREERHKQEKEKIRRGEKKPRKP
Subcellular Location(s) nucl 15.5, cyto_nucl 10, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR013226  Pal1  
Pfam View protein in Pfam  
PF08316  Pal1  
Amino Acid Sequences MALFAGTTAPDRQPSPAPVGLSLSLSSNNPFRNRATSPNPSPSTPVYHTAAATPPPAVQRPAPPMSTNPFLDDSELSQPNSQARANAAALPEDIFNELSLLDKPMSNSQNGVSGAGAYIVRPPTNGAPPRPIGPPPSYRAPDRPSGDRPPRPPRPPRGPASPDKNGFSRPRPRRASESSVMEKERRPRMDRDGFDDRQRTESEEQRRRERRKEREERHKQEKEKIRRGEKKPRKPQGLDIIDKLDVTGIYGQGLFHHDGPFDACNPHRNAKKDRKAPMQAFPADSANMQLGGAGPLRSRLDLDRFHGRGEESFSEYAVTRKPATTVIDPLQRIEPVHGTETYGLGTSTFLEGAPASRSALQRRDSEDPELNSGGGGLSRKKSLAQRFRGMSASRRDRPGDLRSPDARYQIPAQPNGAYSPEVQQLKATSAGGPVQARYNKENEVNVFDNDYEAAFDKKGAQIKIAEQGKPSLGRPRATSSPKAPALSRSLTSDARVPSRGRGSSGEEDRPEKGGVSGFLNRMRSVKGGSRRPTRNVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.34
3 0.34
4 0.34
5 0.32
6 0.34
7 0.32
8 0.28
9 0.25
10 0.19
11 0.18
12 0.17
13 0.19
14 0.21
15 0.26
16 0.28
17 0.31
18 0.32
19 0.38
20 0.4
21 0.46
22 0.49
23 0.53
24 0.57
25 0.64
26 0.65
27 0.59
28 0.59
29 0.54
30 0.53
31 0.46
32 0.44
33 0.37
34 0.36
35 0.35
36 0.33
37 0.33
38 0.28
39 0.25
40 0.21
41 0.2
42 0.22
43 0.24
44 0.25
45 0.25
46 0.29
47 0.36
48 0.39
49 0.4
50 0.37
51 0.39
52 0.42
53 0.45
54 0.39
55 0.35
56 0.33
57 0.31
58 0.31
59 0.27
60 0.24
61 0.26
62 0.28
63 0.26
64 0.24
65 0.26
66 0.27
67 0.29
68 0.26
69 0.21
70 0.2
71 0.23
72 0.23
73 0.24
74 0.21
75 0.19
76 0.19
77 0.18
78 0.16
79 0.12
80 0.12
81 0.1
82 0.09
83 0.08
84 0.08
85 0.08
86 0.08
87 0.1
88 0.09
89 0.1
90 0.12
91 0.2
92 0.22
93 0.21
94 0.22
95 0.2
96 0.26
97 0.25
98 0.24
99 0.16
100 0.14
101 0.13
102 0.13
103 0.12
104 0.07
105 0.1
106 0.11
107 0.11
108 0.11
109 0.14
110 0.16
111 0.25
112 0.3
113 0.29
114 0.33
115 0.35
116 0.38
117 0.39
118 0.37
119 0.33
120 0.33
121 0.36
122 0.35
123 0.41
124 0.42
125 0.42
126 0.47
127 0.46
128 0.49
129 0.48
130 0.49
131 0.47
132 0.55
133 0.61
134 0.61
135 0.66
136 0.68
137 0.74
138 0.76
139 0.79
140 0.79
141 0.8
142 0.8
143 0.78
144 0.77
145 0.74
146 0.74
147 0.73
148 0.71
149 0.64
150 0.59
151 0.55
152 0.51
153 0.5
154 0.49
155 0.52
156 0.52
157 0.59
158 0.63
159 0.65
160 0.66
161 0.69
162 0.68
163 0.64
164 0.63
165 0.58
166 0.56
167 0.54
168 0.49
169 0.45
170 0.45
171 0.47
172 0.46
173 0.44
174 0.45
175 0.52
176 0.59
177 0.57
178 0.56
179 0.57
180 0.53
181 0.55
182 0.54
183 0.45
184 0.39
185 0.38
186 0.35
187 0.3
188 0.35
189 0.4
190 0.44
191 0.48
192 0.56
193 0.65
194 0.67
195 0.73
196 0.76
197 0.76
198 0.79
199 0.85
200 0.85
201 0.87
202 0.91
203 0.9
204 0.91
205 0.89
206 0.82
207 0.8
208 0.8
209 0.79
210 0.78
211 0.77
212 0.76
213 0.78
214 0.82
215 0.84
216 0.84
217 0.85
218 0.86
219 0.87
220 0.85
221 0.78
222 0.77
223 0.76
224 0.72
225 0.63
226 0.54
227 0.47
228 0.38
229 0.35
230 0.28
231 0.18
232 0.1
233 0.08
234 0.07
235 0.05
236 0.05
237 0.05
238 0.05
239 0.05
240 0.08
241 0.08
242 0.09
243 0.09
244 0.09
245 0.09
246 0.1
247 0.1
248 0.09
249 0.1
250 0.1
251 0.14
252 0.17
253 0.23
254 0.26
255 0.31
256 0.4
257 0.49
258 0.57
259 0.6
260 0.64
261 0.67
262 0.71
263 0.69
264 0.67
265 0.62
266 0.55
267 0.48
268 0.42
269 0.34
270 0.26
271 0.22
272 0.16
273 0.1
274 0.08
275 0.06
276 0.05
277 0.05
278 0.05
279 0.06
280 0.06
281 0.06
282 0.08
283 0.08
284 0.08
285 0.09
286 0.1
287 0.14
288 0.16
289 0.2
290 0.26
291 0.26
292 0.26
293 0.27
294 0.25
295 0.21
296 0.24
297 0.22
298 0.17
299 0.16
300 0.16
301 0.16
302 0.15
303 0.16
304 0.13
305 0.14
306 0.11
307 0.11
308 0.12
309 0.14
310 0.17
311 0.18
312 0.2
313 0.22
314 0.27
315 0.27
316 0.27
317 0.26
318 0.23
319 0.21
320 0.19
321 0.17
322 0.13
323 0.15
324 0.14
325 0.13
326 0.13
327 0.13
328 0.12
329 0.1
330 0.08
331 0.06
332 0.06
333 0.06
334 0.06
335 0.06
336 0.05
337 0.05
338 0.05
339 0.06
340 0.08
341 0.07
342 0.08
343 0.12
344 0.14
345 0.19
346 0.25
347 0.28
348 0.3
349 0.35
350 0.39
351 0.38
352 0.41
353 0.42
354 0.37
355 0.37
356 0.34
357 0.28
358 0.22
359 0.2
360 0.14
361 0.1
362 0.1
363 0.1
364 0.11
365 0.12
366 0.13
367 0.17
368 0.24
369 0.33
370 0.42
371 0.47
372 0.53
373 0.54
374 0.56
375 0.57
376 0.52
377 0.48
378 0.49
379 0.51
380 0.48
381 0.5
382 0.49
383 0.48
384 0.52
385 0.53
386 0.52
387 0.46
388 0.48
389 0.48
390 0.52
391 0.51
392 0.49
393 0.42
394 0.36
395 0.37
396 0.37
397 0.38
398 0.34
399 0.33
400 0.3
401 0.3
402 0.29
403 0.26
404 0.2
405 0.16
406 0.18
407 0.22
408 0.22
409 0.21
410 0.21
411 0.21
412 0.22
413 0.22
414 0.19
415 0.13
416 0.14
417 0.15
418 0.17
419 0.17
420 0.16
421 0.21
422 0.24
423 0.27
424 0.28
425 0.31
426 0.31
427 0.34
428 0.38
429 0.33
430 0.36
431 0.35
432 0.33
433 0.32
434 0.27
435 0.24
436 0.2
437 0.18
438 0.12
439 0.11
440 0.12
441 0.1
442 0.11
443 0.12
444 0.16
445 0.22
446 0.22
447 0.23
448 0.24
449 0.26
450 0.35
451 0.38
452 0.35
453 0.31
454 0.33
455 0.34
456 0.34
457 0.34
458 0.34
459 0.35
460 0.36
461 0.39
462 0.43
463 0.48
464 0.52
465 0.56
466 0.52
467 0.57
468 0.58
469 0.57
470 0.52
471 0.48
472 0.48
473 0.45
474 0.41
475 0.36
476 0.36
477 0.35
478 0.35
479 0.36
480 0.34
481 0.34
482 0.36
483 0.33
484 0.36
485 0.42
486 0.42
487 0.4
488 0.39
489 0.42
490 0.47
491 0.52
492 0.52
493 0.48
494 0.49
495 0.48
496 0.47
497 0.4
498 0.32
499 0.27
500 0.22
501 0.2
502 0.22
503 0.26
504 0.28
505 0.32
506 0.34
507 0.34
508 0.33
509 0.34
510 0.31
511 0.31
512 0.35
513 0.4
514 0.47
515 0.55
516 0.64
517 0.69