Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139HET3

Protein Details
Accession A0A139HET3   
Localization Confidence Low
Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
10-36MRPRLACTNCRVRKKKCNKAYPSYSYCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, mito 11, cyto_nucl 8.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MPLPPRIRAMRPRLACTNCRVRKKKCNKAYPSYSYCLKTHDKCPYRAAVNANSTIIAIEIEAPSTYRGRTTQEKPCDNLTDDRMLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.62
3 0.6
4 0.63
5 0.61
6 0.67
7 0.69
8 0.69
9 0.75
10 0.82
11 0.86
12 0.85
13 0.87
14 0.85
15 0.86
16 0.86
17 0.83
18 0.77
19 0.7
20 0.64
21 0.56
22 0.48
23 0.44
24 0.41
25 0.36
26 0.37
27 0.44
28 0.43
29 0.43
30 0.45
31 0.44
32 0.39
33 0.4
34 0.36
35 0.32
36 0.3
37 0.29
38 0.26
39 0.22
40 0.2
41 0.17
42 0.13
43 0.08
44 0.05
45 0.05
46 0.05
47 0.05
48 0.05
49 0.06
50 0.07
51 0.08
52 0.09
53 0.1
54 0.11
55 0.17
56 0.25
57 0.31
58 0.4
59 0.49
60 0.54
61 0.55
62 0.59
63 0.59
64 0.54
65 0.54
66 0.48