Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139GZU6

Protein Details
Accession A0A139GZU6   
Localization Confidence Low
Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
23-43TDFDERTRKRHLRQIWKIARYHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 15, nucl 3, mito 3, mito_nucl 3, E.R. 2, golg 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR021765  UstYa-like  
Gene Ontology GO:0016020  C:membrane  
GO:0043386  P:mycotoxin biosynthetic process  
Pfam View protein in Pfam  
PF11807  UstYa  
Amino Acid Sequences MSYHDPNRHRRTSNSSLEEDLPTDFDERTRKRHLRQIWKIARYVISHILVPFLVVMVAFDMSRESFKRTNDWDVEKTYGTDKRYMSLDHKYDFLWAQDMEVNWGSIKLPKEISDKLGATGIVEYGTIAMFHNLHCLAMMRQTLQEAYYGKRPAFDYRGDKHWPHCLYHLRQAILCHADDTIELPRANNGSLGAVPNISGVTDIRHCRSADKLYKMQDKYVDWGEDDGNGDEHHH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.63
3 0.58
4 0.56
5 0.51
6 0.43
7 0.34
8 0.25
9 0.2
10 0.18
11 0.14
12 0.15
13 0.24
14 0.26
15 0.32
16 0.41
17 0.48
18 0.53
19 0.62
20 0.69
21 0.7
22 0.77
23 0.82
24 0.81
25 0.78
26 0.74
27 0.68
28 0.62
29 0.52
30 0.46
31 0.41
32 0.32
33 0.29
34 0.27
35 0.24
36 0.2
37 0.18
38 0.13
39 0.08
40 0.06
41 0.04
42 0.04
43 0.04
44 0.04
45 0.04
46 0.04
47 0.05
48 0.06
49 0.08
50 0.1
51 0.14
52 0.17
53 0.19
54 0.25
55 0.28
56 0.35
57 0.38
58 0.42
59 0.4
60 0.4
61 0.4
62 0.35
63 0.32
64 0.29
65 0.28
66 0.25
67 0.27
68 0.24
69 0.24
70 0.25
71 0.26
72 0.26
73 0.29
74 0.3
75 0.26
76 0.27
77 0.25
78 0.25
79 0.23
80 0.19
81 0.14
82 0.11
83 0.11
84 0.11
85 0.11
86 0.12
87 0.11
88 0.11
89 0.09
90 0.09
91 0.08
92 0.1
93 0.11
94 0.11
95 0.11
96 0.14
97 0.18
98 0.18
99 0.2
100 0.21
101 0.2
102 0.19
103 0.19
104 0.16
105 0.12
106 0.11
107 0.09
108 0.05
109 0.05
110 0.04
111 0.03
112 0.03
113 0.03
114 0.03
115 0.04
116 0.04
117 0.04
118 0.07
119 0.07
120 0.07
121 0.06
122 0.07
123 0.07
124 0.1
125 0.11
126 0.09
127 0.1
128 0.1
129 0.11
130 0.1
131 0.12
132 0.1
133 0.12
134 0.17
135 0.19
136 0.18
137 0.2
138 0.22
139 0.24
140 0.26
141 0.3
142 0.31
143 0.33
144 0.39
145 0.42
146 0.42
147 0.4
148 0.46
149 0.42
150 0.36
151 0.39
152 0.42
153 0.42
154 0.49
155 0.51
156 0.43
157 0.43
158 0.42
159 0.4
160 0.34
161 0.29
162 0.21
163 0.16
164 0.15
165 0.13
166 0.14
167 0.12
168 0.14
169 0.14
170 0.13
171 0.16
172 0.17
173 0.17
174 0.16
175 0.13
176 0.11
177 0.12
178 0.13
179 0.11
180 0.1
181 0.1
182 0.09
183 0.09
184 0.07
185 0.07
186 0.06
187 0.09
188 0.15
189 0.18
190 0.21
191 0.26
192 0.26
193 0.28
194 0.33
195 0.4
196 0.43
197 0.48
198 0.51
199 0.56
200 0.65
201 0.64
202 0.63
203 0.59
204 0.53
205 0.5
206 0.5
207 0.43
208 0.34
209 0.34
210 0.3
211 0.26
212 0.26
213 0.22
214 0.17