Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139HGA2

Protein Details
Accession A0A139HGA2    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
279-306ELIPSRRRSSSSSKKKKHKGGIYDLEDLHydrophilic
NLS Segment(s)
PositionSequence
284-298RRRSSSSSKKKKHKG
Subcellular Location(s) nucl 23, cyto 3
Family & Domain DBs
Amino Acid Sequences MDQAAVVPHFTYHQWPDQKPPAIQYKPRPLPYQLPSQHLSIPSGFSAPVPAIPLAAPLPFVWDPVNHDYFCYEPETTCFVYFKFGRVYYDELKREHYRPAVPEALNFSKSYPTYRVYQNGEVMFYDPRRKDWYAYDMKYRRIVWRDQRWWPFPQKFSNPQLSPKIKPPKPHSNKFWPSPTYTAAPITVPKQPLKLKYKSDTSSKSSDSDDDDHEAIRVVEVKPDGAASSHAASWSGKSLKEIHRLMDERARLGAITSITSDISPKEVLVLPDSEDESYELIPSRRRSSSSSKKKKHKGGIYDLEDLVARSMRKRRYAYI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.38
3 0.47
4 0.55
5 0.6
6 0.56
7 0.58
8 0.6
9 0.59
10 0.66
11 0.67
12 0.69
13 0.71
14 0.75
15 0.73
16 0.67
17 0.68
18 0.65
19 0.66
20 0.59
21 0.56
22 0.52
23 0.5
24 0.49
25 0.41
26 0.39
27 0.29
28 0.26
29 0.21
30 0.2
31 0.17
32 0.13
33 0.14
34 0.11
35 0.11
36 0.12
37 0.11
38 0.1
39 0.1
40 0.12
41 0.11
42 0.1
43 0.1
44 0.08
45 0.14
46 0.13
47 0.14
48 0.14
49 0.14
50 0.2
51 0.25
52 0.29
53 0.23
54 0.23
55 0.23
56 0.23
57 0.23
58 0.21
59 0.16
60 0.12
61 0.15
62 0.19
63 0.2
64 0.2
65 0.2
66 0.16
67 0.22
68 0.22
69 0.22
70 0.22
71 0.22
72 0.23
73 0.25
74 0.3
75 0.3
76 0.37
77 0.38
78 0.35
79 0.4
80 0.43
81 0.42
82 0.41
83 0.4
84 0.36
85 0.35
86 0.39
87 0.4
88 0.35
89 0.35
90 0.37
91 0.35
92 0.32
93 0.3
94 0.25
95 0.22
96 0.22
97 0.24
98 0.21
99 0.2
100 0.22
101 0.26
102 0.31
103 0.32
104 0.34
105 0.35
106 0.32
107 0.3
108 0.27
109 0.24
110 0.21
111 0.18
112 0.22
113 0.18
114 0.2
115 0.25
116 0.26
117 0.27
118 0.28
119 0.35
120 0.37
121 0.39
122 0.46
123 0.44
124 0.46
125 0.48
126 0.46
127 0.43
128 0.38
129 0.43
130 0.43
131 0.5
132 0.54
133 0.58
134 0.63
135 0.61
136 0.62
137 0.64
138 0.59
139 0.52
140 0.53
141 0.51
142 0.51
143 0.52
144 0.55
145 0.48
146 0.47
147 0.52
148 0.5
149 0.45
150 0.47
151 0.53
152 0.47
153 0.53
154 0.57
155 0.6
156 0.65
157 0.71
158 0.69
159 0.7
160 0.73
161 0.71
162 0.69
163 0.6
164 0.54
165 0.49
166 0.44
167 0.35
168 0.29
169 0.25
170 0.19
171 0.17
172 0.16
173 0.15
174 0.16
175 0.17
176 0.17
177 0.22
178 0.25
179 0.33
180 0.39
181 0.43
182 0.46
183 0.48
184 0.55
185 0.52
186 0.56
187 0.53
188 0.5
189 0.49
190 0.45
191 0.41
192 0.35
193 0.33
194 0.3
195 0.27
196 0.24
197 0.22
198 0.2
199 0.19
200 0.17
201 0.16
202 0.12
203 0.1
204 0.11
205 0.08
206 0.1
207 0.11
208 0.11
209 0.1
210 0.11
211 0.1
212 0.08
213 0.09
214 0.08
215 0.1
216 0.1
217 0.1
218 0.11
219 0.11
220 0.11
221 0.15
222 0.16
223 0.14
224 0.16
225 0.24
226 0.29
227 0.38
228 0.39
229 0.35
230 0.41
231 0.43
232 0.44
233 0.44
234 0.39
235 0.31
236 0.3
237 0.28
238 0.2
239 0.18
240 0.18
241 0.11
242 0.11
243 0.1
244 0.11
245 0.11
246 0.11
247 0.11
248 0.09
249 0.11
250 0.11
251 0.09
252 0.11
253 0.14
254 0.15
255 0.16
256 0.16
257 0.16
258 0.17
259 0.19
260 0.16
261 0.14
262 0.14
263 0.13
264 0.12
265 0.11
266 0.12
267 0.13
268 0.2
269 0.24
270 0.29
271 0.31
272 0.33
273 0.38
274 0.47
275 0.56
276 0.61
277 0.68
278 0.73
279 0.8
280 0.88
281 0.92
282 0.92
283 0.9
284 0.89
285 0.88
286 0.88
287 0.83
288 0.78
289 0.68
290 0.58
291 0.48
292 0.39
293 0.3
294 0.22
295 0.17
296 0.19
297 0.27
298 0.34
299 0.42