Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A139GU30

Protein Details
Accession A0A139GU30    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
51-72GKSKVSGRIEKKSKEKPNKTQKBasic
NLS Segment(s)
PositionSequence
35-72EKSKASERIEKKPRESGKSKVSGRIEKKSKEKPNKTQK
Subcellular Location(s) nucl 20.5, cyto_nucl 14, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MLDEVDKVKQRFEDMFAGFENKLANIEAKMEEVREKSKASERIEKKPRESGKSKVSGRIEKKSKEKPNKTQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.28
3 0.26
4 0.28
5 0.24
6 0.23
7 0.19
8 0.12
9 0.12
10 0.11
11 0.1
12 0.08
13 0.09
14 0.09
15 0.1
16 0.1
17 0.1
18 0.11
19 0.12
20 0.14
21 0.14
22 0.14
23 0.15
24 0.21
25 0.27
26 0.3
27 0.38
28 0.41
29 0.5
30 0.58
31 0.61
32 0.59
33 0.61
34 0.63
35 0.61
36 0.61
37 0.58
38 0.58
39 0.63
40 0.61
41 0.61
42 0.61
43 0.63
44 0.65
45 0.68
46 0.67
47 0.65
48 0.72
49 0.75
50 0.79
51 0.81
52 0.85