Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139HM61

Protein Details
Accession A0A139HM61    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
73-114ENSAPEKPTKGKKRKVECEETKGKKRGRKSKKEKAAEEKAEMBasic
NLS Segment(s)
PositionSequence
79-108KPTKGKKRKVECEETKGKKRGRKSKKEKAA
Subcellular Location(s) nucl 12, mito 11, cyto_nucl 9, cyto 4
Family & Domain DBs
Amino Acid Sequences MAKYNFQLVKQTLTEGEKDRIIAIYLNTADGVTDWAAATNDFGAASAVSMKQSLRNITKKLDKSAVGHAPESENSAPEKPTKGKKRKVECEETKGKKRGRKSKKEKAAEEKAEMGEEEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.29
3 0.3
4 0.26
5 0.25
6 0.24
7 0.21
8 0.19
9 0.17
10 0.13
11 0.14
12 0.13
13 0.13
14 0.13
15 0.12
16 0.11
17 0.09
18 0.1
19 0.06
20 0.06
21 0.05
22 0.06
23 0.06
24 0.06
25 0.07
26 0.05
27 0.05
28 0.04
29 0.05
30 0.04
31 0.04
32 0.04
33 0.05
34 0.05
35 0.05
36 0.05
37 0.06
38 0.08
39 0.1
40 0.15
41 0.2
42 0.25
43 0.27
44 0.31
45 0.39
46 0.38
47 0.39
48 0.38
49 0.33
50 0.31
51 0.35
52 0.36
53 0.3
54 0.28
55 0.26
56 0.23
57 0.22
58 0.23
59 0.17
60 0.13
61 0.13
62 0.14
63 0.14
64 0.15
65 0.19
66 0.2
67 0.3
68 0.4
69 0.49
70 0.57
71 0.66
72 0.75
73 0.81
74 0.85
75 0.86
76 0.83
77 0.82
78 0.83
79 0.82
80 0.81
81 0.79
82 0.77
83 0.72
84 0.75
85 0.77
86 0.77
87 0.8
88 0.81
89 0.84
90 0.88
91 0.92
92 0.91
93 0.91
94 0.9
95 0.85
96 0.78
97 0.72
98 0.62
99 0.53