Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139HPZ3

Protein Details
Accession A0A139HPZ3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
67-90HTTVKIFPFRRSNRKRRWGNLDGGHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 10, mito 8, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR036318  FAD-bd_PCMH-like_sf  
IPR016169  FAD-bd_PCMH_sub2  
Gene Ontology GO:0050660  F:flavin adenine dinucleotide binding  
Amino Acid Sequences MPSANPIGAIPFFLHGDLSPLASRIRFGSDLIVAARLVTAKGEIIDASPDLLYAIRGAGQSFGVILHTTVKIFPFRRSNRKRRWGNLDGGFSSSPFPLAENRGGNYAAYRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.09
3 0.12
4 0.11
5 0.13
6 0.11
7 0.12
8 0.13
9 0.12
10 0.13
11 0.11
12 0.15
13 0.13
14 0.13
15 0.15
16 0.14
17 0.15
18 0.15
19 0.14
20 0.1
21 0.09
22 0.09
23 0.07
24 0.06
25 0.05
26 0.05
27 0.04
28 0.05
29 0.05
30 0.05
31 0.05
32 0.05
33 0.05
34 0.06
35 0.05
36 0.05
37 0.05
38 0.05
39 0.04
40 0.04
41 0.04
42 0.04
43 0.05
44 0.05
45 0.05
46 0.05
47 0.05
48 0.05
49 0.05
50 0.04
51 0.04
52 0.04
53 0.06
54 0.06
55 0.06
56 0.07
57 0.08
58 0.13
59 0.15
60 0.2
61 0.29
62 0.36
63 0.47
64 0.57
65 0.67
66 0.72
67 0.82
68 0.85
69 0.84
70 0.86
71 0.81
72 0.8
73 0.76
74 0.71
75 0.61
76 0.55
77 0.47
78 0.37
79 0.32
80 0.23
81 0.17
82 0.12
83 0.12
84 0.12
85 0.16
86 0.22
87 0.24
88 0.25
89 0.26
90 0.27
91 0.26