Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E5A094

Protein Details
Accession E5A094   
Localization Confidence High
Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
221-242SESSSGKRRRSRPQPLELEKHRBasic
NLS Segment(s)
PositionSequence
139-150NKKKRGRPTKAE
Subcellular Location(s) nucl 20, mito 4, cyto 2
Family & Domain DBs
Amino Acid Sequences MEAAREPPWAEHEKVYLLAEVLKAAPIPSHVLFNIIRDNNIQPRWNDMALPPGRSMHSSQRAFDALAAMYTGSDYRRPPLPVPMVYPGPEATKKRPHPQETTTPIGRLLQPRPPHPYPEYMPAVPAYASAMNPAGEPANKKKRGRPTKAEAQQRAEAAAARGEIYPPPRRGRVSITGPSTESSPQGPESRSHEQRTPPPSAPTQPSSTMTPQQQVGPEQESESSSGKRRRSRPQPLELEKHRALSDMESPLAYGSSSGDPTRNQTYSTYTPISAPLPSSTDSRDRDVRMEGVEETQPRTTTPHSFKDTVGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.3
3 0.24
4 0.19
5 0.18
6 0.16
7 0.14
8 0.13
9 0.11
10 0.1
11 0.1
12 0.09
13 0.09
14 0.14
15 0.14
16 0.16
17 0.16
18 0.2
19 0.2
20 0.22
21 0.29
22 0.25
23 0.25
24 0.25
25 0.3
26 0.34
27 0.38
28 0.4
29 0.31
30 0.38
31 0.41
32 0.39
33 0.35
34 0.28
35 0.34
36 0.32
37 0.34
38 0.28
39 0.25
40 0.26
41 0.27
42 0.3
43 0.3
44 0.37
45 0.37
46 0.37
47 0.38
48 0.38
49 0.36
50 0.33
51 0.25
52 0.15
53 0.13
54 0.12
55 0.08
56 0.07
57 0.07
58 0.07
59 0.06
60 0.1
61 0.1
62 0.13
63 0.18
64 0.21
65 0.23
66 0.3
67 0.35
68 0.34
69 0.37
70 0.38
71 0.35
72 0.33
73 0.33
74 0.25
75 0.23
76 0.27
77 0.27
78 0.29
79 0.37
80 0.42
81 0.51
82 0.59
83 0.61
84 0.63
85 0.65
86 0.68
87 0.65
88 0.66
89 0.58
90 0.49
91 0.43
92 0.38
93 0.35
94 0.31
95 0.28
96 0.27
97 0.3
98 0.33
99 0.41
100 0.4
101 0.43
102 0.39
103 0.42
104 0.38
105 0.41
106 0.42
107 0.33
108 0.32
109 0.27
110 0.25
111 0.2
112 0.17
113 0.11
114 0.08
115 0.07
116 0.07
117 0.08
118 0.07
119 0.07
120 0.08
121 0.07
122 0.07
123 0.11
124 0.18
125 0.28
126 0.35
127 0.37
128 0.43
129 0.53
130 0.63
131 0.69
132 0.68
133 0.66
134 0.7
135 0.76
136 0.78
137 0.72
138 0.65
139 0.59
140 0.51
141 0.43
142 0.33
143 0.26
144 0.17
145 0.13
146 0.08
147 0.07
148 0.07
149 0.07
150 0.08
151 0.12
152 0.17
153 0.21
154 0.24
155 0.26
156 0.27
157 0.29
158 0.33
159 0.36
160 0.36
161 0.38
162 0.38
163 0.36
164 0.35
165 0.34
166 0.29
167 0.23
168 0.17
169 0.13
170 0.11
171 0.12
172 0.14
173 0.15
174 0.16
175 0.23
176 0.3
177 0.34
178 0.36
179 0.39
180 0.41
181 0.47
182 0.5
183 0.49
184 0.43
185 0.41
186 0.41
187 0.42
188 0.42
189 0.38
190 0.36
191 0.33
192 0.33
193 0.33
194 0.33
195 0.34
196 0.31
197 0.3
198 0.27
199 0.27
200 0.26
201 0.25
202 0.24
203 0.21
204 0.2
205 0.18
206 0.18
207 0.16
208 0.17
209 0.18
210 0.17
211 0.22
212 0.28
213 0.35
214 0.42
215 0.49
216 0.57
217 0.66
218 0.74
219 0.76
220 0.8
221 0.83
222 0.83
223 0.85
224 0.8
225 0.78
226 0.68
227 0.61
228 0.51
229 0.42
230 0.35
231 0.28
232 0.28
233 0.22
234 0.21
235 0.18
236 0.18
237 0.17
238 0.16
239 0.13
240 0.08
241 0.07
242 0.09
243 0.11
244 0.12
245 0.14
246 0.15
247 0.2
248 0.26
249 0.25
250 0.25
251 0.24
252 0.31
253 0.32
254 0.37
255 0.35
256 0.29
257 0.29
258 0.3
259 0.3
260 0.24
261 0.21
262 0.18
263 0.18
264 0.19
265 0.2
266 0.22
267 0.29
268 0.31
269 0.34
270 0.39
271 0.38
272 0.4
273 0.41
274 0.39
275 0.33
276 0.32
277 0.28
278 0.25
279 0.27
280 0.26
281 0.26
282 0.26
283 0.25
284 0.24
285 0.27
286 0.28
287 0.33
288 0.38
289 0.43
290 0.48
291 0.49