Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139HQS8

Protein Details
Accession A0A139HQS8    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
88-118LELKAASQLNNKKKNKKKKKLYTPHGYTYHAHydrophilic
NLS Segment(s)
PositionSequence
99-107KKKNKKKKK
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MPHPAKAYSESHAITEAPLSERERFAMVEQMQCGRRKSSQTSPSASLVASATAALKRKAAEPNGVEQNNEAKQGDAPSPPSAVEETPLELKAASQLNNKKKNKKKKKLYTPHGYTYHARPGSVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.18
3 0.17
4 0.13
5 0.16
6 0.18
7 0.19
8 0.19
9 0.2
10 0.2
11 0.19
12 0.18
13 0.23
14 0.22
15 0.22
16 0.23
17 0.27
18 0.29
19 0.32
20 0.33
21 0.28
22 0.3
23 0.32
24 0.38
25 0.43
26 0.47
27 0.49
28 0.51
29 0.51
30 0.49
31 0.44
32 0.37
33 0.28
34 0.2
35 0.15
36 0.1
37 0.07
38 0.06
39 0.07
40 0.09
41 0.09
42 0.09
43 0.1
44 0.13
45 0.17
46 0.18
47 0.21
48 0.21
49 0.26
50 0.32
51 0.31
52 0.28
53 0.24
54 0.27
55 0.23
56 0.23
57 0.18
58 0.11
59 0.12
60 0.14
61 0.15
62 0.12
63 0.14
64 0.13
65 0.14
66 0.13
67 0.14
68 0.13
69 0.11
70 0.12
71 0.1
72 0.11
73 0.12
74 0.12
75 0.11
76 0.1
77 0.1
78 0.13
79 0.14
80 0.15
81 0.22
82 0.3
83 0.4
84 0.51
85 0.59
86 0.65
87 0.72
88 0.81
89 0.85
90 0.88
91 0.89
92 0.9
93 0.94
94 0.95
95 0.96
96 0.95
97 0.92
98 0.9
99 0.83
100 0.76
101 0.69
102 0.64
103 0.63
104 0.53