Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E4ZVL2

Protein Details
Accession E4ZVL2    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
114-148KVQRWATSSARTKRRNKRNRDKYHAKKRAEREKEQBasic
NLS Segment(s)
PositionSequence
123-150ARTKRRNKRNRDKYHAKKRAEREKEQGP
Subcellular Location(s) nucl 18.5, cyto_nucl 12, cyto 4.5, mito 1, pero 1, cysk 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR024526  DUF3807  
Pfam View protein in Pfam  
PF12720  DUF3807  
Amino Acid Sequences MIAQDHAEPTEEYFDVEPEDDLGYYPDGAKRTLTDEQIAIFRHSEIREILRERRSRYNHGDRSEGEVSGNELASADLPPHGHGSPKTTCAATSTGNAYVEDLKQKHSGPGEESKVQRWATSSARTKRRNKRNRDKYHAKKRAEREKEQGPNRKDSGDESDEWDPWHQATGPDAQKEEVFDLDY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.14
4 0.13
5 0.1
6 0.11
7 0.09
8 0.09
9 0.1
10 0.09
11 0.09
12 0.1
13 0.12
14 0.13
15 0.13
16 0.14
17 0.14
18 0.18
19 0.22
20 0.23
21 0.22
22 0.21
23 0.22
24 0.25
25 0.25
26 0.21
27 0.17
28 0.16
29 0.18
30 0.18
31 0.18
32 0.17
33 0.19
34 0.23
35 0.26
36 0.32
37 0.36
38 0.41
39 0.44
40 0.52
41 0.54
42 0.56
43 0.62
44 0.66
45 0.65
46 0.63
47 0.62
48 0.54
49 0.56
50 0.49
51 0.4
52 0.29
53 0.22
54 0.2
55 0.17
56 0.15
57 0.07
58 0.06
59 0.06
60 0.06
61 0.06
62 0.05
63 0.05
64 0.05
65 0.06
66 0.08
67 0.08
68 0.1
69 0.1
70 0.15
71 0.16
72 0.18
73 0.18
74 0.16
75 0.16
76 0.16
77 0.17
78 0.14
79 0.13
80 0.13
81 0.13
82 0.13
83 0.13
84 0.12
85 0.11
86 0.11
87 0.14
88 0.13
89 0.14
90 0.16
91 0.17
92 0.19
93 0.19
94 0.2
95 0.19
96 0.25
97 0.27
98 0.29
99 0.3
100 0.29
101 0.33
102 0.32
103 0.28
104 0.24
105 0.24
106 0.23
107 0.3
108 0.37
109 0.41
110 0.51
111 0.59
112 0.68
113 0.74
114 0.82
115 0.83
116 0.86
117 0.88
118 0.9
119 0.92
120 0.92
121 0.93
122 0.93
123 0.94
124 0.93
125 0.89
126 0.86
127 0.85
128 0.86
129 0.83
130 0.79
131 0.75
132 0.75
133 0.78
134 0.79
135 0.78
136 0.71
137 0.71
138 0.66
139 0.6
140 0.5
141 0.44
142 0.43
143 0.37
144 0.34
145 0.32
146 0.33
147 0.32
148 0.33
149 0.3
150 0.23
151 0.19
152 0.2
153 0.16
154 0.14
155 0.16
156 0.23
157 0.27
158 0.29
159 0.3
160 0.29
161 0.29
162 0.3
163 0.29