Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A139HG29

Protein Details
Accession A0A139HG29    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
60-81RTGNTIRYNAKRRHWRKTRIGIHydrophilic
NLS Segment(s)
PositionSequence
69-78AKRRHWRKTR
Subcellular Location(s) nucl 18, mito_nucl 13.333, cyto_nucl 10.333, mito 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000077  Ribosomal_L39  
IPR023626  Ribosomal_L39e_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00832  Ribosomal_L39  
Amino Acid Sequences LARNSSLSTKTTLPSEDITPSDNRRGNTVNMPSHKTFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.22
4 0.21
5 0.22
6 0.23
7 0.25
8 0.3
9 0.31
10 0.29
11 0.3
12 0.32
13 0.32
14 0.35
15 0.39
16 0.37
17 0.37
18 0.42
19 0.4
20 0.41
21 0.4
22 0.38
23 0.36
24 0.4
25 0.47
26 0.47
27 0.52
28 0.58
29 0.65
30 0.69
31 0.74
32 0.74
33 0.74
34 0.76
35 0.8
36 0.77
37 0.75
38 0.72
39 0.7
40 0.65
41 0.64
42 0.65
43 0.59
44 0.58
45 0.54
46 0.52
47 0.51
48 0.53
49 0.53
50 0.48
51 0.5
52 0.51
53 0.56
54 0.62
55 0.63
56 0.65
57 0.68
58 0.72
59 0.78
60 0.81
61 0.83