Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A139H088

Protein Details
Accession A0A139H088    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
57-83TPPAASVQAPKRKRKRPATSRKPKRCSHydrophilic
NLS Segment(s)
PositionSequence
66-81PKRKRKRPATSRKPKR
Subcellular Location(s) nucl 13, mito 10, cyto 3
Family & Domain DBs
Amino Acid Sequences MPIFPYQYPQQPVAMHAYMAPQHAMSAHPPAFFMPGAPLLQPAAPPVQSTAPLPPPTPPAASVQAPKRKRKRPATSRKPKRCS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.24
3 0.2
4 0.21
5 0.18
6 0.19
7 0.17
8 0.1
9 0.1
10 0.1
11 0.11
12 0.1
13 0.14
14 0.15
15 0.14
16 0.15
17 0.15
18 0.16
19 0.15
20 0.14
21 0.09
22 0.09
23 0.09
24 0.09
25 0.09
26 0.07
27 0.08
28 0.07
29 0.07
30 0.07
31 0.06
32 0.07
33 0.08
34 0.08
35 0.09
36 0.1
37 0.12
38 0.16
39 0.18
40 0.18
41 0.18
42 0.21
43 0.22
44 0.22
45 0.2
46 0.2
47 0.22
48 0.25
49 0.29
50 0.35
51 0.42
52 0.49
53 0.58
54 0.64
55 0.69
56 0.77
57 0.82
58 0.85
59 0.86
60 0.91
61 0.92
62 0.93
63 0.95