Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139H825

Protein Details
Accession A0A139H825    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
334-358GLPSAKRPEPEKRKSWLKRRFTKKDBasic
NLS Segment(s)
PositionSequence
338-358AKRPEPEKRKSWLKRRFTKKD
Subcellular Location(s) nucl 24.5, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018809  DUF2406  
Pfam View protein in Pfam  
PF10295  DUF2406  
Amino Acid Sequences MPDPRPQSPQTPGARSHASRSFSFRSDKSGASQPKEHLVESPKEKQRRDSIWKSTSKANPNAALVEAQPGVNALFEQSTITPLRGIQHKDVYGNPITDPDLANPTRPRMERPLDTIRSFEAAIDSGYKRRSNYMRSESDNNMGGAYAASRRNSAYGEYTHNIRRMSVANPRMSGFGDGPSPNNRYAYGNGGGGYYGGQRDSYSSAGPSARPRYGRGMQSDPMMQARPYPPQHGHQHSQDTMNTAHGSDSTGPWNSGTDPSSENSSIDKNYQNAQQNGYHNGYGPNGFGGPIPEEGGAYPVKPGYAGAPAVQPPNARRPIPLGNSDSMPAMPNGGLPSAKRPEPEKRKSWLKRRFTKKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.54
3 0.55
4 0.53
5 0.49
6 0.46
7 0.5
8 0.49
9 0.45
10 0.5
11 0.44
12 0.45
13 0.44
14 0.43
15 0.4
16 0.45
17 0.48
18 0.47
19 0.52
20 0.46
21 0.51
22 0.52
23 0.47
24 0.43
25 0.42
26 0.44
27 0.46
28 0.54
29 0.54
30 0.6
31 0.62
32 0.64
33 0.67
34 0.69
35 0.71
36 0.71
37 0.72
38 0.74
39 0.77
40 0.73
41 0.72
42 0.7
43 0.69
44 0.67
45 0.62
46 0.56
47 0.51
48 0.5
49 0.42
50 0.34
51 0.26
52 0.22
53 0.17
54 0.13
55 0.11
56 0.1
57 0.09
58 0.08
59 0.08
60 0.06
61 0.05
62 0.05
63 0.07
64 0.07
65 0.1
66 0.11
67 0.11
68 0.11
69 0.12
70 0.16
71 0.21
72 0.25
73 0.27
74 0.32
75 0.33
76 0.34
77 0.35
78 0.35
79 0.32
80 0.28
81 0.24
82 0.2
83 0.2
84 0.19
85 0.18
86 0.14
87 0.18
88 0.18
89 0.22
90 0.23
91 0.25
92 0.29
93 0.3
94 0.33
95 0.34
96 0.4
97 0.38
98 0.44
99 0.5
100 0.49
101 0.49
102 0.45
103 0.38
104 0.34
105 0.31
106 0.24
107 0.15
108 0.1
109 0.1
110 0.12
111 0.12
112 0.13
113 0.17
114 0.18
115 0.18
116 0.24
117 0.29
118 0.31
119 0.39
120 0.44
121 0.46
122 0.49
123 0.53
124 0.49
125 0.47
126 0.43
127 0.34
128 0.26
129 0.21
130 0.16
131 0.11
132 0.09
133 0.09
134 0.1
135 0.1
136 0.11
137 0.11
138 0.12
139 0.13
140 0.14
141 0.13
142 0.13
143 0.18
144 0.18
145 0.21
146 0.23
147 0.26
148 0.25
149 0.22
150 0.22
151 0.19
152 0.21
153 0.26
154 0.28
155 0.27
156 0.28
157 0.28
158 0.27
159 0.25
160 0.24
161 0.16
162 0.11
163 0.12
164 0.11
165 0.12
166 0.15
167 0.16
168 0.16
169 0.16
170 0.16
171 0.15
172 0.16
173 0.18
174 0.16
175 0.15
176 0.14
177 0.14
178 0.12
179 0.11
180 0.1
181 0.07
182 0.05
183 0.05
184 0.05
185 0.05
186 0.06
187 0.08
188 0.09
189 0.08
190 0.08
191 0.1
192 0.11
193 0.13
194 0.17
195 0.19
196 0.22
197 0.23
198 0.25
199 0.3
200 0.35
201 0.38
202 0.37
203 0.38
204 0.35
205 0.36
206 0.35
207 0.29
208 0.25
209 0.22
210 0.17
211 0.16
212 0.17
213 0.22
214 0.23
215 0.27
216 0.28
217 0.34
218 0.42
219 0.45
220 0.48
221 0.46
222 0.5
223 0.46
224 0.47
225 0.4
226 0.35
227 0.29
228 0.26
229 0.21
230 0.16
231 0.14
232 0.11
233 0.12
234 0.11
235 0.11
236 0.12
237 0.13
238 0.13
239 0.13
240 0.14
241 0.13
242 0.15
243 0.14
244 0.13
245 0.14
246 0.15
247 0.19
248 0.19
249 0.18
250 0.17
251 0.19
252 0.18
253 0.2
254 0.22
255 0.19
256 0.22
257 0.29
258 0.35
259 0.34
260 0.36
261 0.39
262 0.39
263 0.43
264 0.42
265 0.36
266 0.29
267 0.29
268 0.27
269 0.21
270 0.19
271 0.14
272 0.11
273 0.11
274 0.1
275 0.11
276 0.11
277 0.11
278 0.12
279 0.11
280 0.11
281 0.1
282 0.12
283 0.11
284 0.09
285 0.1
286 0.09
287 0.09
288 0.08
289 0.09
290 0.08
291 0.11
292 0.12
293 0.12
294 0.16
295 0.18
296 0.2
297 0.22
298 0.23
299 0.24
300 0.32
301 0.38
302 0.35
303 0.34
304 0.39
305 0.45
306 0.48
307 0.51
308 0.46
309 0.43
310 0.43
311 0.42
312 0.37
313 0.29
314 0.25
315 0.18
316 0.14
317 0.12
318 0.12
319 0.12
320 0.13
321 0.14
322 0.14
323 0.22
324 0.26
325 0.28
326 0.3
327 0.35
328 0.45
329 0.54
330 0.62
331 0.62
332 0.66
333 0.74
334 0.81
335 0.86
336 0.86
337 0.86
338 0.87