Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A139H290

Protein Details
Accession A0A139H290    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
65-84YSSPTRTRHRHSSNYKDIRSHydrophilic
NLS Segment(s)
PositionSequence
50-58RSRSRSRGR
Subcellular Location(s) nucl 12, cyto 11, mito 3
Family & Domain DBs
Amino Acid Sequences MLPFGFIPATPVVVVGGRKRLRDIEQVQRGRVVGQVEGYAAAMRDMNRGRSRSRSRGRGLPRITYSSPTRTRHRHSSNYKDIRSSSRHDDRKPKTSDTKTPVTQDAYDKYKQHKAKHEEYRDRLQAGFEGYKKAGYETDKDKDKKPASSTYDRASRYRELEEELRYKDAEVNKYRIEKDEWRREQAVQRRREEQWRRQQELGARAGGNFDPSRAAPRDEVAYINEGSYDDRQPFYPPNHAGGEQRGRVRFQGHGGGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.25
4 0.27
5 0.29
6 0.32
7 0.36
8 0.39
9 0.46
10 0.5
11 0.51
12 0.58
13 0.61
14 0.59
15 0.57
16 0.52
17 0.42
18 0.38
19 0.29
20 0.19
21 0.16
22 0.15
23 0.13
24 0.13
25 0.12
26 0.1
27 0.08
28 0.08
29 0.08
30 0.08
31 0.14
32 0.16
33 0.23
34 0.28
35 0.31
36 0.34
37 0.43
38 0.51
39 0.56
40 0.63
41 0.65
42 0.65
43 0.71
44 0.75
45 0.75
46 0.7
47 0.67
48 0.62
49 0.59
50 0.55
51 0.51
52 0.47
53 0.46
54 0.5
55 0.48
56 0.51
57 0.53
58 0.59
59 0.64
60 0.68
61 0.7
62 0.71
63 0.76
64 0.79
65 0.81
66 0.75
67 0.68
68 0.63
69 0.58
70 0.53
71 0.48
72 0.46
73 0.46
74 0.52
75 0.55
76 0.63
77 0.63
78 0.68
79 0.68
80 0.65
81 0.65
82 0.64
83 0.67
84 0.62
85 0.63
86 0.56
87 0.54
88 0.51
89 0.43
90 0.39
91 0.33
92 0.31
93 0.29
94 0.3
95 0.3
96 0.31
97 0.37
98 0.41
99 0.44
100 0.49
101 0.52
102 0.58
103 0.65
104 0.71
105 0.72
106 0.71
107 0.72
108 0.64
109 0.58
110 0.49
111 0.39
112 0.3
113 0.23
114 0.21
115 0.15
116 0.14
117 0.13
118 0.14
119 0.13
120 0.13
121 0.13
122 0.12
123 0.15
124 0.19
125 0.24
126 0.31
127 0.33
128 0.35
129 0.42
130 0.43
131 0.44
132 0.42
133 0.45
134 0.44
135 0.49
136 0.5
137 0.46
138 0.5
139 0.47
140 0.45
141 0.41
142 0.38
143 0.34
144 0.33
145 0.29
146 0.26
147 0.27
148 0.3
149 0.3
150 0.28
151 0.27
152 0.25
153 0.24
154 0.24
155 0.25
156 0.29
157 0.29
158 0.31
159 0.34
160 0.38
161 0.38
162 0.37
163 0.38
164 0.39
165 0.45
166 0.52
167 0.53
168 0.55
169 0.56
170 0.57
171 0.6
172 0.6
173 0.59
174 0.56
175 0.56
176 0.56
177 0.58
178 0.65
179 0.66
180 0.67
181 0.69
182 0.71
183 0.72
184 0.68
185 0.68
186 0.64
187 0.61
188 0.54
189 0.46
190 0.36
191 0.3
192 0.31
193 0.27
194 0.25
195 0.18
196 0.15
197 0.14
198 0.14
199 0.2
200 0.2
201 0.23
202 0.2
203 0.22
204 0.24
205 0.23
206 0.24
207 0.2
208 0.21
209 0.19
210 0.18
211 0.16
212 0.13
213 0.15
214 0.16
215 0.18
216 0.17
217 0.18
218 0.19
219 0.23
220 0.28
221 0.3
222 0.36
223 0.35
224 0.37
225 0.4
226 0.41
227 0.4
228 0.43
229 0.47
230 0.44
231 0.48
232 0.46
233 0.45
234 0.46
235 0.45
236 0.4
237 0.36