Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E4ZY13

Protein Details
Accession E4ZY13   
Localization Confidence Low
Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
19-42LIMCVKREAKTRKKERERERDDDDBasic
NLS Segment(s)
PositionSequence
27-34AKTRKKER
Subcellular Location(s) cyto 17.5, cyto_nucl 12, cysk 4, nucl 3.5
Family & Domain DBs
Amino Acid Sequences MSGLELASELRIFCLDIALIMCVKREAKTRKKERERERDDDDDGERGRMAGWVGVYGTVGRDNTVGGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.06
3 0.06
4 0.07
5 0.07
6 0.07
7 0.07
8 0.07
9 0.08
10 0.09
11 0.11
12 0.19
13 0.27
14 0.36
15 0.47
16 0.57
17 0.66
18 0.76
19 0.84
20 0.86
21 0.88
22 0.86
23 0.82
24 0.79
25 0.71
26 0.63
27 0.56
28 0.47
29 0.39
30 0.32
31 0.26
32 0.19
33 0.15
34 0.13
35 0.11
36 0.1
37 0.07
38 0.07
39 0.07
40 0.07
41 0.07
42 0.07
43 0.07
44 0.08
45 0.09
46 0.09
47 0.09
48 0.09