Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E4ZP13

Protein Details
Accession E4ZP13    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MVRHRDHNRPGSRRSRQDYDBasic
NLS Segment(s)
Subcellular Location(s) mito 10, cyto_nucl 8, nucl 7.5, cyto 7.5
Family & Domain DBs
Amino Acid Sequences MVRHRDHNRPGSRRSRQDYDEIRLGLTTPKGEATWDWALTNDHISVKITIGTLVTPTPRTTRQYGTKGPTTPHMPPLRATRALPTTDDEEAKATLLAKVILANRRGRPDGCARRAMARDRRGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.78
3 0.71
4 0.74
5 0.71
6 0.67
7 0.64
8 0.54
9 0.46
10 0.38
11 0.36
12 0.29
13 0.23
14 0.17
15 0.11
16 0.12
17 0.12
18 0.12
19 0.12
20 0.15
21 0.17
22 0.17
23 0.16
24 0.17
25 0.18
26 0.17
27 0.19
28 0.13
29 0.11
30 0.1
31 0.11
32 0.11
33 0.1
34 0.1
35 0.09
36 0.08
37 0.08
38 0.07
39 0.07
40 0.07
41 0.07
42 0.07
43 0.08
44 0.11
45 0.14
46 0.17
47 0.19
48 0.24
49 0.3
50 0.35
51 0.39
52 0.41
53 0.43
54 0.41
55 0.39
56 0.38
57 0.35
58 0.31
59 0.34
60 0.33
61 0.29
62 0.31
63 0.36
64 0.38
65 0.35
66 0.34
67 0.31
68 0.31
69 0.32
70 0.3
71 0.26
72 0.24
73 0.23
74 0.23
75 0.19
76 0.17
77 0.16
78 0.15
79 0.13
80 0.1
81 0.09
82 0.09
83 0.09
84 0.07
85 0.1
86 0.14
87 0.19
88 0.23
89 0.29
90 0.32
91 0.38
92 0.42
93 0.39
94 0.41
95 0.47
96 0.53
97 0.52
98 0.54
99 0.5
100 0.55
101 0.6
102 0.64
103 0.63