Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139GYY5

Protein Details
Accession A0A139GYY5    Localization Confidence High Confidence Score 18.4
NoLS Segment(s)
PositionSequenceProtein Nature
166-188AGSTHRRPGKKSRIKMRTKAAAAHydrophilic
201-235SKEAAEQEKRTRRNREKKVKKKNREKAKKAEAALTBasic
NLS Segment(s)
PositionSequence
170-230HRRPGKKSRIKMRTKAAAAKAKEAQALEAAASKEAAEQEKRTRRNREKKVKKKNREKAKKA
Subcellular Location(s) nucl 21, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR018555  DUF2011  
Pfam View protein in Pfam  
PF09428  DUF2011  
Amino Acid Sequences MERVVARSELLSEASTPPSSPDLSNITTLGQFEFVNRKQHVNEDANDGEDELDFQLFAPSAKSGDDDHVVAKIRIATPEASEREPGFIRPHRDDSYYFKKPVSTEERQNYEAAALSGQDILMASQKPWPGMACPWKLLEIPASRKQQILLDGSDAAYRKLLGHHVAGSTHRRPGKKSRIKMRTKAAAAKAKEAQALEAAASKEAAEQEKRTRRNREKKVKKKNREKAKKAEAALTAPAGLNTEMAHGEPDVDTD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.16
4 0.17
5 0.18
6 0.2
7 0.18
8 0.2
9 0.22
10 0.23
11 0.25
12 0.23
13 0.21
14 0.2
15 0.21
16 0.17
17 0.14
18 0.12
19 0.13
20 0.21
21 0.23
22 0.31
23 0.32
24 0.35
25 0.35
26 0.4
27 0.46
28 0.42
29 0.4
30 0.39
31 0.38
32 0.36
33 0.34
34 0.29
35 0.21
36 0.16
37 0.14
38 0.08
39 0.08
40 0.06
41 0.06
42 0.06
43 0.06
44 0.07
45 0.07
46 0.07
47 0.07
48 0.08
49 0.09
50 0.09
51 0.12
52 0.13
53 0.13
54 0.13
55 0.15
56 0.17
57 0.15
58 0.15
59 0.15
60 0.14
61 0.14
62 0.15
63 0.13
64 0.14
65 0.21
66 0.22
67 0.21
68 0.22
69 0.21
70 0.22
71 0.22
72 0.22
73 0.22
74 0.24
75 0.29
76 0.31
77 0.36
78 0.35
79 0.37
80 0.38
81 0.4
82 0.44
83 0.44
84 0.41
85 0.36
86 0.36
87 0.34
88 0.39
89 0.39
90 0.36
91 0.38
92 0.44
93 0.47
94 0.46
95 0.46
96 0.38
97 0.3
98 0.25
99 0.17
100 0.1
101 0.06
102 0.05
103 0.05
104 0.05
105 0.04
106 0.04
107 0.04
108 0.05
109 0.06
110 0.05
111 0.08
112 0.09
113 0.09
114 0.1
115 0.1
116 0.09
117 0.14
118 0.2
119 0.19
120 0.2
121 0.2
122 0.21
123 0.21
124 0.2
125 0.21
126 0.19
127 0.23
128 0.3
129 0.33
130 0.33
131 0.33
132 0.33
133 0.3
134 0.29
135 0.25
136 0.18
137 0.16
138 0.15
139 0.15
140 0.16
141 0.14
142 0.11
143 0.09
144 0.08
145 0.07
146 0.08
147 0.1
148 0.1
149 0.11
150 0.12
151 0.13
152 0.14
153 0.17
154 0.22
155 0.22
156 0.26
157 0.29
158 0.3
159 0.34
160 0.43
161 0.51
162 0.55
163 0.63
164 0.67
165 0.73
166 0.81
167 0.84
168 0.83
169 0.8
170 0.75
171 0.73
172 0.71
173 0.68
174 0.61
175 0.58
176 0.53
177 0.46
178 0.43
179 0.36
180 0.28
181 0.21
182 0.2
183 0.15
184 0.14
185 0.13
186 0.11
187 0.11
188 0.1
189 0.1
190 0.12
191 0.15
192 0.15
193 0.19
194 0.29
195 0.38
196 0.46
197 0.53
198 0.63
199 0.7
200 0.78
201 0.85
202 0.87
203 0.89
204 0.92
205 0.96
206 0.96
207 0.96
208 0.96
209 0.95
210 0.96
211 0.95
212 0.94
213 0.93
214 0.93
215 0.89
216 0.81
217 0.77
218 0.69
219 0.6
220 0.53
221 0.43
222 0.33
223 0.25
224 0.22
225 0.17
226 0.14
227 0.11
228 0.09
229 0.1
230 0.09
231 0.09
232 0.1
233 0.09
234 0.1