Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A139HRS7

Protein Details
Accession A0A139HRS7    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
30-60QVFECSKPRPQHPKHPKYPKHPKLPKQVWTIHydrophilic
NLS Segment(s)
PositionSequence
39-52PQHPKHPKYPKHPK
Subcellular Location(s) nucl 19.5, cyto_nucl 13.333, mito_nucl 11.666, cyto 5
Family & Domain DBs
Amino Acid Sequences MSLAAEIGQEKYLAKRAQLERDLQGVELVQVFECSKPRPQHPKHPKYPKHPKLPKQVWTIVSGIIRGVVHLLHLNGESVARTSQAQPHTPTTTKVSTSKPVTSGPVMPHTTPKSSINPKPTSSQSHAPIYPVPKPHSTTLVRHTYAAQP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.29
3 0.34
4 0.43
5 0.47
6 0.48
7 0.43
8 0.46
9 0.45
10 0.35
11 0.3
12 0.21
13 0.17
14 0.14
15 0.12
16 0.08
17 0.08
18 0.09
19 0.1
20 0.12
21 0.14
22 0.2
23 0.25
24 0.34
25 0.44
26 0.5
27 0.6
28 0.69
29 0.77
30 0.81
31 0.87
32 0.86
33 0.86
34 0.91
35 0.89
36 0.89
37 0.88
38 0.86
39 0.86
40 0.86
41 0.82
42 0.78
43 0.74
44 0.64
45 0.57
46 0.49
47 0.4
48 0.32
49 0.24
50 0.17
51 0.12
52 0.1
53 0.08
54 0.07
55 0.05
56 0.05
57 0.05
58 0.06
59 0.05
60 0.05
61 0.05
62 0.05
63 0.05
64 0.05
65 0.05
66 0.05
67 0.05
68 0.06
69 0.07
70 0.12
71 0.15
72 0.18
73 0.2
74 0.24
75 0.27
76 0.27
77 0.29
78 0.28
79 0.28
80 0.27
81 0.29
82 0.28
83 0.31
84 0.34
85 0.34
86 0.31
87 0.31
88 0.31
89 0.29
90 0.29
91 0.25
92 0.27
93 0.28
94 0.26
95 0.31
96 0.31
97 0.31
98 0.31
99 0.32
100 0.34
101 0.4
102 0.46
103 0.49
104 0.51
105 0.51
106 0.54
107 0.55
108 0.55
109 0.52
110 0.53
111 0.49
112 0.51
113 0.49
114 0.46
115 0.45
116 0.42
117 0.42
118 0.41
119 0.4
120 0.39
121 0.42
122 0.43
123 0.46
124 0.46
125 0.47
126 0.49
127 0.54
128 0.5
129 0.47