Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A139GZP6

Protein Details
Accession A0A139GZP6    Localization Confidence High Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
13-35PTNPYHSARPHPHHRHDPRHVHFBasic
69-99AGLLPRIRVKTKRPKDRRRRRVYVDDTPLRYBasic
NLS Segment(s)
PositionSequence
74-89RIRVKTKRPKDRRRRR
Subcellular Location(s) nucl 22, cyto_nucl 13, mito 3
Family & Domain DBs
Amino Acid Sequences MSSSAGFTSTKGPTNPYHSARPHPHHRHDPRHVHFADDDLTPSALTLRIKLGPNTRPTAVIKISIYFEAGLLPRIRVKTKRPKDRRRRRVYVDDTPLRY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.42
3 0.41
4 0.46
5 0.46
6 0.54
7 0.59
8 0.63
9 0.66
10 0.68
11 0.72
12 0.75
13 0.81
14 0.82
15 0.83
16 0.85
17 0.79
18 0.79
19 0.71
20 0.62
21 0.52
22 0.44
23 0.35
24 0.25
25 0.21
26 0.12
27 0.12
28 0.09
29 0.09
30 0.08
31 0.08
32 0.08
33 0.07
34 0.08
35 0.12
36 0.13
37 0.15
38 0.2
39 0.23
40 0.27
41 0.29
42 0.28
43 0.27
44 0.28
45 0.29
46 0.25
47 0.23
48 0.2
49 0.18
50 0.19
51 0.16
52 0.16
53 0.12
54 0.11
55 0.09
56 0.09
57 0.11
58 0.1
59 0.11
60 0.14
61 0.17
62 0.22
63 0.26
64 0.35
65 0.44
66 0.54
67 0.64
68 0.72
69 0.81
70 0.87
71 0.94
72 0.95
73 0.95
74 0.94
75 0.92
76 0.92
77 0.9
78 0.89
79 0.88