Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A109FD94

Protein Details
Accession A0A109FD94    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MGKRKSSKKPQTRVKQVLDKSFRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKSSKKPQTRVKQVLDKSFRCMFCARTGSVTCKMDTKNRVGRLQCKDCNQSFQVHLSEPVDVYSAWIDACELSAATNFH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.87
3 0.82
4 0.82
5 0.8
6 0.7
7 0.65
8 0.63
9 0.54
10 0.48
11 0.43
12 0.35
13 0.33
14 0.35
15 0.3
16 0.27
17 0.29
18 0.3
19 0.34
20 0.34
21 0.27
22 0.27
23 0.28
24 0.3
25 0.32
26 0.34
27 0.35
28 0.38
29 0.43
30 0.42
31 0.49
32 0.52
33 0.56
34 0.54
35 0.52
36 0.54
37 0.5
38 0.53
39 0.46
40 0.41
41 0.34
42 0.33
43 0.29
44 0.24
45 0.25
46 0.2
47 0.19
48 0.16
49 0.14
50 0.12
51 0.1
52 0.1
53 0.08
54 0.08
55 0.07
56 0.07
57 0.07
58 0.06
59 0.07
60 0.06
61 0.06
62 0.06