Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A109FIS4

Protein Details
Accession A0A109FIS4   
Localization Confidence High
Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
79-100KGHSCYRPRRTGERKRKSVRGCBasic
182-203VTPERLQRRRHLRSLARRKTEAHydrophilic
NLS Segment(s)
PositionSequence
88-95RTGERKRK
133-142LGPKRATKIR
159-208RREVVPKKEGAKPYTKAPKIQRLVTPERLQRRRHLRSLARRKTEAQKAQK
217-234KRLAERKVAASAVKAKKA
Subcellular Location(s) cyto 13, cyto_nucl 10.833, mito_nucl 7.666, mito 7.5, nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR014401  Ribosomal_S6_euk  
IPR001377  Ribosomal_S6e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01092  Ribosomal_S6e  
Amino Acid Sequences MKLVLANPATGQQKTIEIDDERKTRIFYEKRMAQEVAADQLGDEFKGYVVRITGGNDKQGFPLKQGVLVPHRVRLLLAKGHSCYRPRRTGERKRKSVRGCIVGPDVRALHLVVVKQGENDIPGLTDEVLPKRLGPKRATKIRRFFNLDKSDDVRKFVIRREVVPKKEGAKPYTKAPKIQRLVTPERLQRRRHLRSLARRKTEAQKAQKAEYEQIVAKRLAERKVAASAVKAKKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.25
3 0.24
4 0.23
5 0.28
6 0.34
7 0.37
8 0.36
9 0.35
10 0.35
11 0.32
12 0.39
13 0.4
14 0.4
15 0.46
16 0.49
17 0.52
18 0.56
19 0.54
20 0.44
21 0.43
22 0.37
23 0.3
24 0.24
25 0.19
26 0.14
27 0.15
28 0.15
29 0.11
30 0.09
31 0.06
32 0.06
33 0.08
34 0.09
35 0.08
36 0.08
37 0.09
38 0.1
39 0.12
40 0.19
41 0.19
42 0.25
43 0.25
44 0.25
45 0.27
46 0.33
47 0.31
48 0.26
49 0.31
50 0.25
51 0.27
52 0.27
53 0.29
54 0.26
55 0.33
56 0.32
57 0.29
58 0.3
59 0.27
60 0.26
61 0.24
62 0.24
63 0.21
64 0.22
65 0.21
66 0.23
67 0.26
68 0.3
69 0.32
70 0.36
71 0.39
72 0.45
73 0.47
74 0.56
75 0.63
76 0.7
77 0.77
78 0.79
79 0.83
80 0.81
81 0.85
82 0.8
83 0.78
84 0.73
85 0.68
86 0.58
87 0.51
88 0.49
89 0.42
90 0.37
91 0.29
92 0.23
93 0.17
94 0.16
95 0.13
96 0.09
97 0.08
98 0.08
99 0.08
100 0.09
101 0.08
102 0.08
103 0.08
104 0.08
105 0.07
106 0.07
107 0.06
108 0.05
109 0.05
110 0.05
111 0.05
112 0.06
113 0.07
114 0.08
115 0.1
116 0.1
117 0.1
118 0.17
119 0.21
120 0.25
121 0.28
122 0.37
123 0.44
124 0.55
125 0.63
126 0.65
127 0.69
128 0.7
129 0.74
130 0.72
131 0.67
132 0.67
133 0.66
134 0.59
135 0.54
136 0.51
137 0.51
138 0.43
139 0.42
140 0.34
141 0.3
142 0.3
143 0.31
144 0.36
145 0.3
146 0.33
147 0.41
148 0.47
149 0.47
150 0.47
151 0.47
152 0.42
153 0.47
154 0.49
155 0.43
156 0.42
157 0.41
158 0.48
159 0.55
160 0.54
161 0.55
162 0.57
163 0.63
164 0.6
165 0.63
166 0.59
167 0.56
168 0.61
169 0.62
170 0.62
171 0.59
172 0.64
173 0.66
174 0.65
175 0.67
176 0.7
177 0.7
178 0.7
179 0.73
180 0.72
181 0.76
182 0.84
183 0.85
184 0.82
185 0.77
186 0.76
187 0.76
188 0.76
189 0.75
190 0.73
191 0.72
192 0.7
193 0.7
194 0.69
195 0.63
196 0.56
197 0.49
198 0.43
199 0.38
200 0.36
201 0.36
202 0.31
203 0.3
204 0.32
205 0.35
206 0.34
207 0.35
208 0.34
209 0.33
210 0.38
211 0.38
212 0.33
213 0.33
214 0.39