Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A109FI99

Protein Details
Accession A0A109FI99    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
270-299PPTTFRPIPPEKRLRRREPSRDHDRDRDREBasic
390-410DEDRRRPSSGRHDEERRTRRTBasic
NLS Segment(s)
PositionSequence
278-332PPEKRLRRREPSRDHDRDRDRERERDRDRDGHRSSSSRYDRDDRRDERERSPRRR
Subcellular Location(s) nucl 21.5, cyto_nucl 14, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004882  Luc7-rel  
Gene Ontology GO:0005685  C:U1 snRNP  
GO:0003729  F:mRNA binding  
GO:0006376  P:mRNA splice site selection  
Pfam View protein in Pfam  
PF03194  LUC7  
Amino Acid Sequences EQQRKLLEQLMGPEALGIVQHNISLYDPKLCHPFVAGICPHDLFTNTKMDLGPCAKTHSVKLKTEYEDLSRKAEAEKDEHQIKIFNTFKADYEREIMNFVGECDRRIAAAHRRLEKTPEENNRTTALMREVGEIEGAYQAAMADVETLGSQGKVEESMTQLTKAEALKTEKLEKERELQQLIETAGASGHQKLRVCDICGAYLSVLDSDRRLADHFGGKMHLGYHQLRQLIDEWRARGPLPTAPLPAVVHNPANGVGGPNGSLASNAAAPPTTFRPIPPEKRLRRREPSRDHDRDRDRERERDRDRDGHRSSSSRYDRDDRRDERERSPRRRSSAAGAADDSYHHHRSSSRRDGDAASSSGYRSSRTVTDDKERDPRDRDERRSSRYHDDEDRRRPSSGRHDEERRTRRTYDDIDEPNRTAASDKRRRVDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.15
3 0.13
4 0.09
5 0.08
6 0.08
7 0.08
8 0.09
9 0.09
10 0.11
11 0.14
12 0.15
13 0.2
14 0.2
15 0.23
16 0.29
17 0.29
18 0.28
19 0.26
20 0.31
21 0.26
22 0.33
23 0.31
24 0.27
25 0.29
26 0.29
27 0.27
28 0.23
29 0.23
30 0.19
31 0.19
32 0.24
33 0.22
34 0.23
35 0.24
36 0.23
37 0.28
38 0.28
39 0.29
40 0.23
41 0.28
42 0.3
43 0.31
44 0.36
45 0.4
46 0.44
47 0.46
48 0.51
49 0.52
50 0.53
51 0.56
52 0.52
53 0.49
54 0.49
55 0.46
56 0.43
57 0.37
58 0.33
59 0.31
60 0.32
61 0.29
62 0.27
63 0.29
64 0.33
65 0.36
66 0.36
67 0.35
68 0.35
69 0.32
70 0.36
71 0.35
72 0.29
73 0.29
74 0.29
75 0.3
76 0.34
77 0.35
78 0.27
79 0.28
80 0.28
81 0.24
82 0.25
83 0.23
84 0.17
85 0.15
86 0.14
87 0.18
88 0.16
89 0.16
90 0.17
91 0.17
92 0.16
93 0.17
94 0.22
95 0.25
96 0.33
97 0.39
98 0.44
99 0.47
100 0.49
101 0.52
102 0.52
103 0.49
104 0.5
105 0.53
106 0.53
107 0.52
108 0.52
109 0.49
110 0.45
111 0.39
112 0.32
113 0.24
114 0.2
115 0.19
116 0.18
117 0.17
118 0.16
119 0.16
120 0.13
121 0.11
122 0.08
123 0.07
124 0.05
125 0.04
126 0.04
127 0.04
128 0.04
129 0.03
130 0.03
131 0.03
132 0.03
133 0.03
134 0.04
135 0.04
136 0.04
137 0.04
138 0.04
139 0.04
140 0.05
141 0.05
142 0.06
143 0.07
144 0.11
145 0.11
146 0.12
147 0.12
148 0.11
149 0.14
150 0.13
151 0.13
152 0.14
153 0.17
154 0.2
155 0.22
156 0.28
157 0.28
158 0.31
159 0.33
160 0.31
161 0.32
162 0.36
163 0.38
164 0.34
165 0.31
166 0.28
167 0.27
168 0.25
169 0.2
170 0.13
171 0.09
172 0.07
173 0.08
174 0.08
175 0.07
176 0.09
177 0.11
178 0.13
179 0.13
180 0.19
181 0.21
182 0.22
183 0.23
184 0.22
185 0.2
186 0.19
187 0.19
188 0.13
189 0.11
190 0.09
191 0.06
192 0.06
193 0.06
194 0.05
195 0.06
196 0.06
197 0.07
198 0.07
199 0.08
200 0.09
201 0.12
202 0.13
203 0.12
204 0.13
205 0.13
206 0.12
207 0.11
208 0.11
209 0.12
210 0.13
211 0.15
212 0.17
213 0.19
214 0.18
215 0.19
216 0.2
217 0.19
218 0.22
219 0.22
220 0.2
221 0.2
222 0.21
223 0.2
224 0.18
225 0.17
226 0.14
227 0.16
228 0.16
229 0.16
230 0.15
231 0.17
232 0.16
233 0.16
234 0.15
235 0.14
236 0.12
237 0.12
238 0.12
239 0.11
240 0.11
241 0.1
242 0.08
243 0.07
244 0.06
245 0.06
246 0.06
247 0.06
248 0.05
249 0.05
250 0.05
251 0.05
252 0.06
253 0.05
254 0.06
255 0.05
256 0.06
257 0.08
258 0.11
259 0.12
260 0.12
261 0.12
262 0.2
263 0.28
264 0.36
265 0.43
266 0.51
267 0.59
268 0.69
269 0.79
270 0.8
271 0.82
272 0.85
273 0.87
274 0.86
275 0.86
276 0.86
277 0.86
278 0.83
279 0.82
280 0.8
281 0.79
282 0.75
283 0.75
284 0.69
285 0.69
286 0.69
287 0.7
288 0.67
289 0.67
290 0.67
291 0.66
292 0.66
293 0.67
294 0.65
295 0.61
296 0.58
297 0.52
298 0.49
299 0.51
300 0.53
301 0.46
302 0.47
303 0.49
304 0.53
305 0.58
306 0.65
307 0.59
308 0.61
309 0.67
310 0.67
311 0.68
312 0.71
313 0.73
314 0.73
315 0.79
316 0.78
317 0.74
318 0.74
319 0.68
320 0.65
321 0.63
322 0.57
323 0.49
324 0.43
325 0.37
326 0.33
327 0.3
328 0.27
329 0.24
330 0.22
331 0.2
332 0.2
333 0.24
334 0.32
335 0.42
336 0.48
337 0.48
338 0.47
339 0.5
340 0.51
341 0.5
342 0.47
343 0.37
344 0.29
345 0.24
346 0.22
347 0.24
348 0.22
349 0.19
350 0.16
351 0.18
352 0.19
353 0.25
354 0.3
355 0.32
356 0.42
357 0.45
358 0.49
359 0.55
360 0.56
361 0.57
362 0.57
363 0.59
364 0.6
365 0.65
366 0.68
367 0.7
368 0.74
369 0.75
370 0.77
371 0.75
372 0.75
373 0.72
374 0.7
375 0.69
376 0.71
377 0.75
378 0.77
379 0.79
380 0.72
381 0.67
382 0.62
383 0.6
384 0.61
385 0.61
386 0.59
387 0.6
388 0.66
389 0.73
390 0.83
391 0.83
392 0.79
393 0.74
394 0.68
395 0.64
396 0.64
397 0.61
398 0.56
399 0.57
400 0.58
401 0.59
402 0.61
403 0.57
404 0.51
405 0.45
406 0.38
407 0.32
408 0.31
409 0.35
410 0.41
411 0.48