Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A109FHY8

Protein Details
Accession A0A109FHY8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
23-47TKSHTLCRRCGRRSFHKQHKSCASCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, mito_nucl 13.333, cyto_mito 12.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR011331  Ribosomal_L37ae/L37e  
IPR001569  Ribosomal_L37e  
IPR018267  Ribosomal_L37e_CS  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0046872  F:metal ion binding  
GO:0019843  F:rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01907  Ribosomal_L37e  
PROSITE View protein in PROSITE  
PS01077  RIBOSOMAL_L37E  
Amino Acid Sequences MLTFFFASLPRTKGTTSFGLRHTKSHTLCRRCGRRSFHKQHKSCASCGYPAAKLRSYEWGQKAKRRHTTGTGRMQYMKHVSRRFKNGFREGTTATRKAKPSSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.31
3 0.32
4 0.34
5 0.38
6 0.45
7 0.45
8 0.46
9 0.48
10 0.48
11 0.46
12 0.52
13 0.56
14 0.54
15 0.6
16 0.67
17 0.71
18 0.68
19 0.73
20 0.71
21 0.72
22 0.77
23 0.8
24 0.81
25 0.82
26 0.79
27 0.79
28 0.81
29 0.73
30 0.63
31 0.59
32 0.49
33 0.4
34 0.39
35 0.32
36 0.25
37 0.25
38 0.26
39 0.22
40 0.21
41 0.21
42 0.26
43 0.26
44 0.3
45 0.32
46 0.38
47 0.4
48 0.45
49 0.52
50 0.54
51 0.61
52 0.59
53 0.58
54 0.58
55 0.64
56 0.67
57 0.7
58 0.65
59 0.58
60 0.56
61 0.53
62 0.49
63 0.46
64 0.44
65 0.41
66 0.45
67 0.51
68 0.55
69 0.65
70 0.68
71 0.68
72 0.71
73 0.72
74 0.71
75 0.68
76 0.65
77 0.59
78 0.6
79 0.59
80 0.55
81 0.52
82 0.51
83 0.51