Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A109FHM8

Protein Details
Accession A0A109FHM8   
Localization Confidence Medium
Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
252-275ETSNFRRLGKSKKDERDRRRMEEEBasic
NLS Segment(s)
PositionSequence
194-198KGKKK
259-271LGKSKKDERDRRR
287-288GK
331-333KPK
354-358GKRTK
363-369KAVKRAN
Subcellular Location(s) nucl 14, cyto_nucl 11.166, mito_nucl 10.666, cyto_mito 7.166, cyto 7, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR007146  Sas10/Utp3/C1D  
Pfam View protein in Pfam  
PF04000  Sas10_Utp3  
Amino Acid Sequences MARSVSPEQPTLGPQVAALRAHLAEIRNGVQQANESALAWKQKRAETDELDYAAGISLLSLKNHLLLSYLQHLVALFSLKISSKSLVQSGPASRVVAHLVKLRVVLEKVAPLELKLKYQVEKLVRKADQFDDQGGTQNEEDVLNDPLAFRPNPSNLVLDRTVSEGEDEEEADERAGIYRPPRLAAMPYVEAPAKGKKKREAAQQPSHLLSDMSHSMLSSTPYAEATSGLSVSYDPSLKSGAKARLDKILEYETSNFRRLGKSKKDERDRRRMEEEVAFGGLGAGKGGKRRLGGFGAEFDDLLGHGNTNNGASQKGEKRKAAAYEQMAGFKKPKMARPERDFDGPGSSGLGGGAGKRTKSQFDKAVKRANSSKRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.23
3 0.24
4 0.23
5 0.21
6 0.19
7 0.17
8 0.18
9 0.21
10 0.17
11 0.17
12 0.19
13 0.21
14 0.21
15 0.22
16 0.21
17 0.19
18 0.2
19 0.19
20 0.18
21 0.17
22 0.14
23 0.15
24 0.18
25 0.26
26 0.25
27 0.28
28 0.31
29 0.34
30 0.38
31 0.44
32 0.48
33 0.44
34 0.49
35 0.48
36 0.44
37 0.41
38 0.35
39 0.29
40 0.21
41 0.16
42 0.09
43 0.05
44 0.08
45 0.08
46 0.09
47 0.1
48 0.1
49 0.13
50 0.13
51 0.13
52 0.11
53 0.11
54 0.14
55 0.18
56 0.19
57 0.16
58 0.16
59 0.16
60 0.15
61 0.15
62 0.13
63 0.08
64 0.07
65 0.09
66 0.09
67 0.11
68 0.12
69 0.13
70 0.14
71 0.16
72 0.19
73 0.18
74 0.2
75 0.23
76 0.23
77 0.25
78 0.24
79 0.22
80 0.19
81 0.2
82 0.21
83 0.18
84 0.18
85 0.2
86 0.19
87 0.2
88 0.2
89 0.2
90 0.19
91 0.18
92 0.18
93 0.13
94 0.15
95 0.15
96 0.16
97 0.15
98 0.13
99 0.17
100 0.17
101 0.17
102 0.19
103 0.2
104 0.2
105 0.22
106 0.28
107 0.31
108 0.36
109 0.39
110 0.43
111 0.43
112 0.43
113 0.44
114 0.41
115 0.39
116 0.34
117 0.32
118 0.25
119 0.23
120 0.27
121 0.24
122 0.23
123 0.16
124 0.15
125 0.14
126 0.12
127 0.12
128 0.09
129 0.09
130 0.08
131 0.08
132 0.08
133 0.08
134 0.11
135 0.1
136 0.1
137 0.12
138 0.14
139 0.17
140 0.18
141 0.2
142 0.17
143 0.22
144 0.21
145 0.18
146 0.17
147 0.16
148 0.14
149 0.12
150 0.12
151 0.07
152 0.08
153 0.07
154 0.07
155 0.06
156 0.06
157 0.06
158 0.06
159 0.05
160 0.04
161 0.05
162 0.06
163 0.06
164 0.07
165 0.1
166 0.11
167 0.12
168 0.13
169 0.12
170 0.13
171 0.14
172 0.15
173 0.13
174 0.13
175 0.13
176 0.13
177 0.12
178 0.13
179 0.18
180 0.23
181 0.26
182 0.3
183 0.35
184 0.43
185 0.48
186 0.57
187 0.61
188 0.63
189 0.68
190 0.69
191 0.65
192 0.59
193 0.53
194 0.43
195 0.32
196 0.23
197 0.17
198 0.12
199 0.1
200 0.09
201 0.08
202 0.09
203 0.09
204 0.1
205 0.08
206 0.07
207 0.07
208 0.08
209 0.08
210 0.08
211 0.07
212 0.07
213 0.07
214 0.06
215 0.06
216 0.05
217 0.05
218 0.06
219 0.07
220 0.07
221 0.07
222 0.07
223 0.1
224 0.1
225 0.12
226 0.18
227 0.23
228 0.28
229 0.31
230 0.32
231 0.37
232 0.38
233 0.36
234 0.33
235 0.3
236 0.24
237 0.23
238 0.25
239 0.24
240 0.26
241 0.28
242 0.26
243 0.25
244 0.3
245 0.33
246 0.4
247 0.44
248 0.5
249 0.58
250 0.67
251 0.76
252 0.81
253 0.86
254 0.87
255 0.85
256 0.82
257 0.78
258 0.71
259 0.64
260 0.58
261 0.51
262 0.41
263 0.33
264 0.26
265 0.2
266 0.17
267 0.13
268 0.08
269 0.06
270 0.06
271 0.06
272 0.1
273 0.12
274 0.15
275 0.16
276 0.18
277 0.21
278 0.23
279 0.25
280 0.23
281 0.24
282 0.24
283 0.22
284 0.21
285 0.16
286 0.14
287 0.11
288 0.11
289 0.09
290 0.06
291 0.06
292 0.07
293 0.08
294 0.08
295 0.1
296 0.09
297 0.09
298 0.11
299 0.18
300 0.27
301 0.36
302 0.42
303 0.43
304 0.46
305 0.5
306 0.54
307 0.52
308 0.51
309 0.45
310 0.45
311 0.45
312 0.48
313 0.44
314 0.41
315 0.38
316 0.33
317 0.37
318 0.35
319 0.41
320 0.45
321 0.53
322 0.62
323 0.68
324 0.73
325 0.7
326 0.71
327 0.65
328 0.56
329 0.51
330 0.42
331 0.34
332 0.28
333 0.22
334 0.16
335 0.14
336 0.14
337 0.08
338 0.08
339 0.14
340 0.15
341 0.17
342 0.21
343 0.25
344 0.32
345 0.38
346 0.45
347 0.49
348 0.56
349 0.66
350 0.7
351 0.77
352 0.71
353 0.73
354 0.74