Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A109FF65

Protein Details
Accession A0A109FF65    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
64-84SEEQAKKRSRKTVKANRGVIGHydrophilic
NLS Segment(s)
PositionSequence
60-78KKGISEEQAKKRSRKTVKA
Subcellular Location(s) cyto 11, mito 10, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR038630  L24e/L24_sf  
IPR000988  Ribosomal_L24e-rel  
IPR023442  Ribosomal_L24e_CS  
Gene Ontology GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF01246  Ribosomal_L24e  
PROSITE View protein in PROSITE  
PS01073  RIBOSOMAL_L24E  
CDD cd00472  Ribosomal_L24e_L24  
Amino Acid Sequences MKVEFCNFSGYKIYPGQGRLFVRTDSKIFRFASSKEESLFLQRKNPRKIAWTVVYRRVNKKGISEEQAKKRSRKTVKANRGVIGADVAAIQAKRQQKPEVRAAQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.29
3 0.29
4 0.31
5 0.32
6 0.32
7 0.31
8 0.31
9 0.32
10 0.31
11 0.32
12 0.3
13 0.3
14 0.32
15 0.31
16 0.32
17 0.31
18 0.29
19 0.33
20 0.31
21 0.3
22 0.25
23 0.25
24 0.23
25 0.28
26 0.32
27 0.26
28 0.3
29 0.35
30 0.43
31 0.48
32 0.51
33 0.45
34 0.45
35 0.47
36 0.45
37 0.45
38 0.44
39 0.41
40 0.47
41 0.52
42 0.52
43 0.54
44 0.53
45 0.51
46 0.45
47 0.45
48 0.43
49 0.4
50 0.42
51 0.46
52 0.48
53 0.53
54 0.6
55 0.61
56 0.59
57 0.6
58 0.64
59 0.64
60 0.66
61 0.68
62 0.71
63 0.77
64 0.82
65 0.81
66 0.72
67 0.66
68 0.56
69 0.45
70 0.35
71 0.24
72 0.14
73 0.09
74 0.08
75 0.08
76 0.07
77 0.07
78 0.12
79 0.2
80 0.24
81 0.29
82 0.38
83 0.45
84 0.52
85 0.62