Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E5ABP1

Protein Details
Accession E5ABP1    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
52-74INSGAKRVRKRTEKERSGKEMRVBasic
NLS Segment(s)
PositionSequence
57-67KRVRKRTEKER
Subcellular Location(s) mito 9, nucl 6.5, pero 6, cyto_nucl 5.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MWIATQYAMSIDSHVDTLPQPLVGYNAGLYVPYVQYYTGTVRPSQHLLCVAINSGAKRVRKRTEKERSGKEMRVAFFFFE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.08
4 0.11
5 0.1
6 0.1
7 0.09
8 0.08
9 0.1
10 0.09
11 0.09
12 0.07
13 0.07
14 0.06
15 0.06
16 0.06
17 0.06
18 0.06
19 0.06
20 0.06
21 0.05
22 0.06
23 0.07
24 0.1
25 0.12
26 0.13
27 0.13
28 0.15
29 0.16
30 0.19
31 0.18
32 0.17
33 0.15
34 0.16
35 0.15
36 0.14
37 0.13
38 0.12
39 0.13
40 0.12
41 0.14
42 0.18
43 0.22
44 0.27
45 0.35
46 0.42
47 0.51
48 0.58
49 0.65
50 0.72
51 0.78
52 0.82
53 0.83
54 0.83
55 0.81
56 0.78
57 0.74
58 0.69
59 0.61
60 0.56