Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E5A7X2

Protein Details
Accession E5A7X2    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
211-238RSPPRPPHRPLRLRTIPRQHPPWRRLPLBasic
NLS Segment(s)
PositionSequence
145-246PSKSERDRERERRDGERDRERDKDRDRELRRPASSRKEKEGRIPTQSRPSRPGNLHQAPRKPLPLGRSPPRPPHRPLRLRTIPRQHPPWRRLPLPHLLRLGG
Subcellular Location(s) nucl 12, cyto_nucl 10, mito 9, cyto 6
Family & Domain DBs
Amino Acid Sequences MAAPRRPTNINHHPRPTGPHSVLDSPSKSTASNGYNGYNGYNGSFATPNRSGYFSANKQLPSTPASSLPAHIQSQTWEPRTPATNYDFSSGGETPNTPQVDSEPATPDTQLAGRMGRLGETSHKKPPRRDSWMAFKGFFGASPSPSKSERDRERERRDGERDRERDKDRDRELRRPASSRKEKEGRIPTQSRPSRPGNLHQAPRKPLPLGRSPPRPPHRPLRLRTIPRQHPPWRRLPLPHLLRLGGHHVRRGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.69
3 0.65
4 0.64
5 0.56
6 0.52
7 0.5
8 0.5
9 0.51
10 0.49
11 0.44
12 0.38
13 0.38
14 0.33
15 0.28
16 0.25
17 0.29
18 0.25
19 0.28
20 0.27
21 0.26
22 0.26
23 0.26
24 0.25
25 0.2
26 0.17
27 0.13
28 0.12
29 0.1
30 0.11
31 0.13
32 0.12
33 0.19
34 0.2
35 0.22
36 0.23
37 0.25
38 0.24
39 0.26
40 0.34
41 0.3
42 0.35
43 0.36
44 0.35
45 0.34
46 0.34
47 0.33
48 0.27
49 0.26
50 0.21
51 0.2
52 0.22
53 0.21
54 0.21
55 0.22
56 0.22
57 0.21
58 0.2
59 0.18
60 0.16
61 0.22
62 0.27
63 0.27
64 0.25
65 0.25
66 0.27
67 0.3
68 0.3
69 0.28
70 0.26
71 0.27
72 0.27
73 0.28
74 0.26
75 0.23
76 0.25
77 0.21
78 0.17
79 0.13
80 0.13
81 0.12
82 0.17
83 0.17
84 0.13
85 0.13
86 0.13
87 0.17
88 0.17
89 0.18
90 0.15
91 0.16
92 0.17
93 0.16
94 0.15
95 0.12
96 0.12
97 0.11
98 0.09
99 0.07
100 0.07
101 0.08
102 0.08
103 0.07
104 0.07
105 0.07
106 0.13
107 0.18
108 0.22
109 0.29
110 0.36
111 0.4
112 0.46
113 0.55
114 0.57
115 0.6
116 0.63
117 0.59
118 0.63
119 0.66
120 0.61
121 0.52
122 0.43
123 0.36
124 0.3
125 0.25
126 0.18
127 0.12
128 0.12
129 0.14
130 0.15
131 0.16
132 0.18
133 0.21
134 0.22
135 0.31
136 0.37
137 0.44
138 0.53
139 0.61
140 0.68
141 0.73
142 0.73
143 0.71
144 0.71
145 0.71
146 0.69
147 0.69
148 0.66
149 0.62
150 0.66
151 0.62
152 0.63
153 0.6
154 0.61
155 0.59
156 0.63
157 0.65
158 0.66
159 0.7
160 0.7
161 0.68
162 0.65
163 0.65
164 0.66
165 0.71
166 0.67
167 0.68
168 0.66
169 0.65
170 0.68
171 0.7
172 0.65
173 0.64
174 0.63
175 0.59
176 0.63
177 0.67
178 0.61
179 0.57
180 0.57
181 0.56
182 0.55
183 0.58
184 0.58
185 0.6
186 0.64
187 0.66
188 0.67
189 0.65
190 0.65
191 0.61
192 0.53
193 0.48
194 0.45
195 0.47
196 0.49
197 0.52
198 0.58
199 0.61
200 0.69
201 0.75
202 0.75
203 0.72
204 0.74
205 0.76
206 0.76
207 0.74
208 0.74
209 0.76
210 0.78
211 0.82
212 0.82
213 0.8
214 0.8
215 0.85
216 0.84
217 0.84
218 0.82
219 0.82
220 0.8
221 0.76
222 0.74
223 0.71
224 0.72
225 0.69
226 0.69
227 0.62
228 0.55
229 0.5
230 0.46
231 0.48
232 0.46
233 0.41