Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A109FKI4

Protein Details
Accession A0A109FKI4    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
20-48AVKKAPAGGDDKKRKRKTRKETYSSYIYKHydrophilic
NLS Segment(s)
PositionSequence
12-39AGKAPAKKAVKKAPAGGDDKKRKRKTRK
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR007125  Histone_H2A/H2B/H3  
IPR000558  Histone_H2B  
Gene Ontology GO:0000786  C:nucleosome  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
Pfam View protein in Pfam  
PF00125  Histone  
PROSITE View protein in PROSITE  
PS00357  HISTONE_H2B  
Amino Acid Sequences MAPKSTTAEAPAGKAPAKKAVKKAPAGGDDKKRKRKTRKETYSSYIYKVLKQVHPDTGISNKAMLILNSFVNDIFERIASEASKLASYNKKSTISSREIQTSVRLILPGELSKHAISEGTKAVTKFSSTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.26
3 0.31
4 0.38
5 0.41
6 0.47
7 0.54
8 0.59
9 0.61
10 0.65
11 0.62
12 0.61
13 0.61
14 0.6
15 0.61
16 0.64
17 0.7
18 0.74
19 0.77
20 0.8
21 0.85
22 0.89
23 0.9
24 0.9
25 0.91
26 0.89
27 0.86
28 0.82
29 0.8
30 0.71
31 0.63
32 0.58
33 0.48
34 0.42
35 0.39
36 0.38
37 0.32
38 0.35
39 0.34
40 0.31
41 0.32
42 0.3
43 0.27
44 0.25
45 0.24
46 0.19
47 0.16
48 0.12
49 0.12
50 0.12
51 0.1
52 0.08
53 0.08
54 0.08
55 0.08
56 0.08
57 0.06
58 0.07
59 0.07
60 0.07
61 0.06
62 0.06
63 0.06
64 0.06
65 0.07
66 0.06
67 0.07
68 0.07
69 0.08
70 0.08
71 0.08
72 0.12
73 0.19
74 0.22
75 0.26
76 0.29
77 0.32
78 0.33
79 0.37
80 0.4
81 0.39
82 0.39
83 0.39
84 0.39
85 0.37
86 0.37
87 0.35
88 0.3
89 0.25
90 0.22
91 0.19
92 0.14
93 0.15
94 0.16
95 0.16
96 0.16
97 0.16
98 0.18
99 0.17
100 0.17
101 0.16
102 0.16
103 0.14
104 0.16
105 0.18
106 0.18
107 0.21
108 0.21
109 0.23
110 0.22