Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A109FDU5

Protein Details
Accession A0A109FDU5    Localization Confidence Low Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
39-60QSVRRKNRVYIICRNNPKHRQVHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 10.166, nucl 10, cyto_mito 9.166, mito 8, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
Amino Acid Sequences LGAPSRPGSGANALASASVGGERGMKVRSSVKLYCDGCQSVRRKNRVYIICRNNPKHRQV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.11
4 0.07
5 0.05
6 0.04
7 0.04
8 0.05
9 0.05
10 0.07
11 0.08
12 0.08
13 0.1
14 0.13
15 0.16
16 0.2
17 0.21
18 0.21
19 0.28
20 0.29
21 0.29
22 0.29
23 0.28
24 0.25
25 0.31
26 0.33
27 0.35
28 0.43
29 0.48
30 0.5
31 0.54
32 0.61
33 0.63
34 0.66
35 0.67
36 0.69
37 0.72
38 0.78
39 0.8
40 0.81