Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A120E602

Protein Details
Accession A0A120E602    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
16-40LWKMPWRMSKTRKMRQRLRLKAVDDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFRPTAPTNVGLLWKMPWRMSKTRKMRQRLRLKAVDDVISTLRASGVQTQSLSAALALPRETEMPAKDKYTTFSRTDVGYRKGMHKTPHFTKITSRTNPKGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.18
3 0.18
4 0.21
5 0.21
6 0.22
7 0.26
8 0.31
9 0.4
10 0.47
11 0.55
12 0.61
13 0.68
14 0.75
15 0.79
16 0.82
17 0.82
18 0.86
19 0.85
20 0.83
21 0.81
22 0.74
23 0.69
24 0.61
25 0.52
26 0.41
27 0.33
28 0.25
29 0.19
30 0.16
31 0.11
32 0.09
33 0.07
34 0.07
35 0.1
36 0.1
37 0.1
38 0.11
39 0.11
40 0.11
41 0.11
42 0.1
43 0.06
44 0.06
45 0.05
46 0.05
47 0.05
48 0.05
49 0.06
50 0.07
51 0.07
52 0.09
53 0.1
54 0.13
55 0.15
56 0.16
57 0.18
58 0.18
59 0.21
60 0.25
61 0.28
62 0.27
63 0.27
64 0.27
65 0.27
66 0.32
67 0.34
68 0.33
69 0.33
70 0.33
71 0.37
72 0.41
73 0.44
74 0.47
75 0.49
76 0.54
77 0.56
78 0.63
79 0.6
80 0.55
81 0.59
82 0.61
83 0.63
84 0.63
85 0.66