Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A109FNS2

Protein Details
Accession A0A109FNS2   
Localization Confidence High
Confidence Score 18.2
NoLS Segment(s)
PositionSequenceProtein Nature
198-220LCRECAKKLRYGRQKAKDIREEKBasic
237-262PPLSSPSSSKRQRHRHASRSCPPPPSHydrophilic
287-306LPPDLDHHHRQQRRRNDPSSBasic
308-332GGDRDRDRSSRERRRRSASPLSRRQBasic
NLS Segment(s)
PositionSequence
309-331GDRDRDRSSRERRRRSASPLSRR
Subcellular Location(s) nucl 22, cyto_nucl 15.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019129  Folate-sensitive_fs_Fra10Ac1  
Pfam View protein in Pfam  
PF09725  Fra10Ac1  
Amino Acid Sequences MPRQTRPAAASTSFEPPNAHDRLQRMHSLRQFYENSRGNRLPAKPRSRGELDVLQERHQFVRDSRVDPSTLPWEDQLASKFYDSLFKEYAVVNLKHYKSGAVALRWRTEEEVLSGIGHLTCGSLRCRYHEPSPSIVAAQQQADDTSSSIFTTSEANIASLADPDSETPLVEARLEELEMPFGYLEQGVKKSALVKVVLCRECAKKLRYGRQKAKDIREEKERDSSGSGMDSTSALPPPLSSPSSSKRQRHRHASRSCPPPPSRPPAPRRSSTAKEDQDDDDDFRPELPPDLDHHHRQQRRRNDPSSGGGDRDRDRSSRERRRRSASPLSRRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.29
3 0.27
4 0.32
5 0.33
6 0.32
7 0.3
8 0.33
9 0.39
10 0.43
11 0.48
12 0.45
13 0.5
14 0.53
15 0.56
16 0.54
17 0.54
18 0.54
19 0.5
20 0.56
21 0.54
22 0.52
23 0.53
24 0.52
25 0.49
26 0.52
27 0.54
28 0.54
29 0.57
30 0.62
31 0.62
32 0.63
33 0.67
34 0.65
35 0.62
36 0.57
37 0.54
38 0.49
39 0.5
40 0.49
41 0.45
42 0.43
43 0.41
44 0.36
45 0.32
46 0.3
47 0.22
48 0.31
49 0.32
50 0.31
51 0.33
52 0.34
53 0.33
54 0.31
55 0.33
56 0.31
57 0.27
58 0.25
59 0.22
60 0.22
61 0.22
62 0.24
63 0.22
64 0.16
65 0.16
66 0.15
67 0.16
68 0.14
69 0.2
70 0.19
71 0.22
72 0.22
73 0.21
74 0.22
75 0.22
76 0.26
77 0.25
78 0.24
79 0.23
80 0.29
81 0.29
82 0.29
83 0.29
84 0.26
85 0.2
86 0.25
87 0.25
88 0.22
89 0.27
90 0.28
91 0.31
92 0.31
93 0.32
94 0.27
95 0.25
96 0.21
97 0.17
98 0.15
99 0.12
100 0.11
101 0.1
102 0.09
103 0.07
104 0.07
105 0.05
106 0.04
107 0.05
108 0.06
109 0.08
110 0.13
111 0.14
112 0.18
113 0.23
114 0.27
115 0.32
116 0.38
117 0.4
118 0.38
119 0.4
120 0.36
121 0.32
122 0.29
123 0.25
124 0.18
125 0.15
126 0.12
127 0.1
128 0.1
129 0.1
130 0.09
131 0.07
132 0.06
133 0.06
134 0.06
135 0.06
136 0.06
137 0.05
138 0.07
139 0.07
140 0.07
141 0.07
142 0.07
143 0.07
144 0.07
145 0.07
146 0.06
147 0.06
148 0.05
149 0.05
150 0.05
151 0.06
152 0.06
153 0.06
154 0.05
155 0.06
156 0.06
157 0.06
158 0.06
159 0.05
160 0.06
161 0.06
162 0.06
163 0.05
164 0.06
165 0.06
166 0.06
167 0.05
168 0.04
169 0.04
170 0.05
171 0.05
172 0.06
173 0.07
174 0.08
175 0.08
176 0.08
177 0.1
178 0.12
179 0.14
180 0.13
181 0.14
182 0.18
183 0.26
184 0.26
185 0.25
186 0.27
187 0.27
188 0.32
189 0.37
190 0.34
191 0.34
192 0.41
193 0.5
194 0.57
195 0.65
196 0.7
197 0.73
198 0.8
199 0.81
200 0.81
201 0.81
202 0.75
203 0.69
204 0.68
205 0.64
206 0.57
207 0.57
208 0.49
209 0.41
210 0.38
211 0.34
212 0.25
213 0.22
214 0.19
215 0.11
216 0.11
217 0.1
218 0.08
219 0.09
220 0.09
221 0.08
222 0.08
223 0.08
224 0.09
225 0.13
226 0.13
227 0.13
228 0.18
229 0.23
230 0.34
231 0.42
232 0.49
233 0.55
234 0.65
235 0.73
236 0.79
237 0.84
238 0.84
239 0.85
240 0.88
241 0.87
242 0.85
243 0.81
244 0.79
245 0.73
246 0.72
247 0.7
248 0.68
249 0.68
250 0.69
251 0.73
252 0.74
253 0.77
254 0.72
255 0.72
256 0.72
257 0.69
258 0.66
259 0.67
260 0.63
261 0.59
262 0.57
263 0.52
264 0.48
265 0.44
266 0.4
267 0.32
268 0.27
269 0.24
270 0.22
271 0.21
272 0.17
273 0.18
274 0.16
275 0.15
276 0.18
277 0.25
278 0.31
279 0.36
280 0.44
281 0.51
282 0.57
283 0.64
284 0.7
285 0.74
286 0.78
287 0.82
288 0.79
289 0.77
290 0.75
291 0.74
292 0.72
293 0.63
294 0.56
295 0.5
296 0.5
297 0.45
298 0.45
299 0.41
300 0.35
301 0.39
302 0.45
303 0.53
304 0.59
305 0.67
306 0.72
307 0.77
308 0.84
309 0.86
310 0.85
311 0.85
312 0.85