Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A109FKS3

Protein Details
Accession A0A109FKS3   
Localization Confidence Low
Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
3-22RATARRCLPRRSPPPTPATSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, plas 4, nucl 2, extr 2, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR022764  Peptidase_S54_rhomboid_dom  
IPR035952  Rhomboid-like_sf  
Gene Ontology GO:0016020  C:membrane  
GO:0004252  F:serine-type endopeptidase activity  
Pfam View protein in Pfam  
PF01694  Rhomboid  
Amino Acid Sequences MFRATARRCLPRRSPPPTPATSSAPASRTAPPAVQPISFRATRQVGFTAATVVLAIGAGAWYTNQDTLERTSSSSSLFSSWSRTLSGAPGTGLQPSLARQRWEETYARASEWVARVPGNRLAIILAENWVEMSEAKRTSAGLIASFVGIWLAWKLPAKLGIGQWLAHQPLSGKAITLFTSTFSHRTLTHLGFNSIALFSFSGATFAALSHAGADLLPRSTSRYEFLTLFATAGVVSALASHLWFSRVIAGGLLRRGLTTREVRSAVLPSLGASGAVYALVSLTALSFPSTSVSLIFLPFFPIPIGLATSALVAVDVIGLVRGWRMFDHAAHLAGAAMGAGWCLAGHALFEQVRTWMWDGQKQRIEEEQGRRRDRGVGGWVSI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.78
3 0.81
4 0.77
5 0.75
6 0.69
7 0.65
8 0.6
9 0.56
10 0.52
11 0.45
12 0.42
13 0.38
14 0.37
15 0.34
16 0.33
17 0.3
18 0.28
19 0.33
20 0.33
21 0.32
22 0.3
23 0.3
24 0.33
25 0.32
26 0.3
27 0.3
28 0.32
29 0.31
30 0.32
31 0.3
32 0.26
33 0.26
34 0.26
35 0.21
36 0.16
37 0.15
38 0.12
39 0.09
40 0.08
41 0.06
42 0.06
43 0.03
44 0.03
45 0.03
46 0.03
47 0.03
48 0.04
49 0.05
50 0.07
51 0.08
52 0.09
53 0.11
54 0.15
55 0.18
56 0.18
57 0.18
58 0.19
59 0.19
60 0.2
61 0.19
62 0.16
63 0.14
64 0.16
65 0.15
66 0.19
67 0.19
68 0.19
69 0.19
70 0.19
71 0.19
72 0.19
73 0.2
74 0.15
75 0.14
76 0.15
77 0.14
78 0.14
79 0.13
80 0.11
81 0.1
82 0.12
83 0.19
84 0.21
85 0.22
86 0.23
87 0.26
88 0.29
89 0.33
90 0.32
91 0.28
92 0.3
93 0.3
94 0.29
95 0.26
96 0.23
97 0.23
98 0.22
99 0.21
100 0.16
101 0.16
102 0.17
103 0.2
104 0.23
105 0.21
106 0.19
107 0.17
108 0.16
109 0.15
110 0.14
111 0.11
112 0.08
113 0.07
114 0.06
115 0.06
116 0.06
117 0.06
118 0.05
119 0.06
120 0.09
121 0.1
122 0.1
123 0.11
124 0.11
125 0.11
126 0.13
127 0.13
128 0.09
129 0.09
130 0.09
131 0.09
132 0.09
133 0.08
134 0.05
135 0.04
136 0.04
137 0.04
138 0.04
139 0.05
140 0.07
141 0.07
142 0.08
143 0.11
144 0.12
145 0.14
146 0.14
147 0.17
148 0.17
149 0.17
150 0.18
151 0.18
152 0.17
153 0.14
154 0.14
155 0.1
156 0.11
157 0.13
158 0.12
159 0.09
160 0.09
161 0.1
162 0.11
163 0.11
164 0.09
165 0.09
166 0.11
167 0.12
168 0.13
169 0.12
170 0.13
171 0.12
172 0.16
173 0.18
174 0.18
175 0.21
176 0.2
177 0.2
178 0.19
179 0.18
180 0.16
181 0.12
182 0.1
183 0.06
184 0.05
185 0.05
186 0.05
187 0.05
188 0.05
189 0.05
190 0.05
191 0.05
192 0.05
193 0.05
194 0.05
195 0.05
196 0.04
197 0.04
198 0.04
199 0.04
200 0.04
201 0.04
202 0.05
203 0.05
204 0.05
205 0.08
206 0.09
207 0.1
208 0.12
209 0.13
210 0.15
211 0.15
212 0.17
213 0.16
214 0.15
215 0.14
216 0.12
217 0.1
218 0.07
219 0.07
220 0.05
221 0.03
222 0.03
223 0.03
224 0.03
225 0.03
226 0.03
227 0.04
228 0.04
229 0.05
230 0.05
231 0.06
232 0.08
233 0.09
234 0.09
235 0.09
236 0.1
237 0.11
238 0.12
239 0.12
240 0.1
241 0.09
242 0.1
243 0.11
244 0.15
245 0.19
246 0.21
247 0.25
248 0.26
249 0.26
250 0.27
251 0.28
252 0.23
253 0.18
254 0.15
255 0.11
256 0.11
257 0.11
258 0.09
259 0.06
260 0.06
261 0.05
262 0.05
263 0.04
264 0.03
265 0.03
266 0.03
267 0.03
268 0.03
269 0.03
270 0.03
271 0.04
272 0.04
273 0.05
274 0.05
275 0.07
276 0.07
277 0.07
278 0.07
279 0.09
280 0.09
281 0.1
282 0.1
283 0.09
284 0.12
285 0.12
286 0.12
287 0.11
288 0.1
289 0.1
290 0.1
291 0.11
292 0.07
293 0.08
294 0.08
295 0.08
296 0.07
297 0.06
298 0.06
299 0.04
300 0.04
301 0.03
302 0.03
303 0.03
304 0.03
305 0.03
306 0.03
307 0.05
308 0.05
309 0.06
310 0.06
311 0.11
312 0.13
313 0.13
314 0.19
315 0.2
316 0.2
317 0.2
318 0.19
319 0.15
320 0.13
321 0.12
322 0.06
323 0.04
324 0.03
325 0.03
326 0.03
327 0.03
328 0.03
329 0.03
330 0.03
331 0.03
332 0.04
333 0.05
334 0.1
335 0.1
336 0.11
337 0.12
338 0.13
339 0.14
340 0.16
341 0.19
342 0.19
343 0.22
344 0.28
345 0.33
346 0.41
347 0.47
348 0.45
349 0.46
350 0.47
351 0.51
352 0.53
353 0.59
354 0.58
355 0.63
356 0.67
357 0.65
358 0.61
359 0.6
360 0.54
361 0.5
362 0.49