Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A109FDN6

Protein Details
Accession A0A109FDN6    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-47MAATSIKIVKKRTKPFKRHQSDRYHGVKEAWRKPKGIDNRVRRRFKGHydrophilic
NLS Segment(s)
PositionSequence
9-49VKKRTKPFKRHQSDRYHGVKEAWRKPKGIDNRVRRRFKGQL
Subcellular Location(s) mito 14.5, mito_nucl 11, nucl 6.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAATSIKIVKKRTKPFKRHQSDRYHGVKEAWRKPKGIDNRVRRRFKGQLPMPKIGYGSNKKTRHVLPCGYKKFLVHNERDLESLLMNSKVFAAEIASTVSARKRVTILEKARVLGVKVTNSQAKVRVEEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.87
3 0.91
4 0.92
5 0.92
6 0.91
7 0.9
8 0.87
9 0.85
10 0.82
11 0.74
12 0.64
13 0.59
14 0.55
15 0.54
16 0.56
17 0.56
18 0.51
19 0.49
20 0.5
21 0.55
22 0.58
23 0.59
24 0.59
25 0.61
26 0.69
27 0.78
28 0.82
29 0.76
30 0.73
31 0.71
32 0.67
33 0.67
34 0.64
35 0.64
36 0.63
37 0.65
38 0.59
39 0.52
40 0.46
41 0.37
42 0.37
43 0.33
44 0.35
45 0.4
46 0.41
47 0.41
48 0.45
49 0.47
50 0.45
51 0.44
52 0.43
53 0.42
54 0.49
55 0.52
56 0.51
57 0.47
58 0.42
59 0.42
60 0.45
61 0.43
62 0.36
63 0.38
64 0.39
65 0.39
66 0.38
67 0.33
68 0.25
69 0.18
70 0.16
71 0.12
72 0.1
73 0.09
74 0.08
75 0.08
76 0.07
77 0.07
78 0.06
79 0.06
80 0.05
81 0.06
82 0.07
83 0.07
84 0.07
85 0.08
86 0.1
87 0.13
88 0.13
89 0.14
90 0.14
91 0.19
92 0.25
93 0.34
94 0.39
95 0.43
96 0.45
97 0.45
98 0.46
99 0.43
100 0.37
101 0.32
102 0.3
103 0.25
104 0.26
105 0.3
106 0.33
107 0.34
108 0.36
109 0.37
110 0.37