Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A109FCT2

Protein Details
Accession A0A109FCT2    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
359-384YTPIDTAKQLRKRRLRRGEDPRVLPAHydrophilic
NLS Segment(s)
PositionSequence
369-375RKRRLRR
Subcellular Location(s) mito 17, cyto 5.5, cyto_nucl 5.5, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007133  RNA_pol_II-assoc_Paf1  
Gene Ontology GO:0016593  C:Cdc73/Paf1 complex  
GO:0016570  P:histone modification  
GO:0006368  P:transcription elongation by RNA polymerase II  
Pfam View protein in Pfam  
PF03985  Paf1  
Amino Acid Sequences MSSQKSSKADLLVRVRYQNPLPAPPFPPKLLHIPTTPHRYATYDFLAPIQGERELPMILDAELGMPLELGKTAPGAPSMGGDYWLGNRSAIAPPPLTKGNEDANIGDEDAFLLDDPTAAATSTAAGSGPGTPGRANVVDVSKKVDVSWLRKTEYLSSEAGNMRHALQNLNGNAKPAPAELDPLDRDGRAAAIAATFDAAHIPLSELRHPTKRGVTAVESFDLLPDDDLWANEYDLVRFGEDPSSIATNEPPRLGPDPRLPRAIFRDLTEVLPEGQGRVAYYLPINDDTALSYTEKRYSAEETLEDEAFEFRWVRDYEIAGMRQLTQEFVFSFDAGEEATAGEAKVKPITTAARQKGAYYTPIDTAKQLRKRRLRRGEDPRVLPAPIDPETGMPEEAFWDGINLKLVAPEKSFPPEELARWRAFKEQVSAPLPRPVQETAAAKREGEKVDVGESAAANGVAEGQATVVEEAMQALEGGAQAASGESQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.54
3 0.53
4 0.51
5 0.5
6 0.46
7 0.47
8 0.46
9 0.46
10 0.48
11 0.51
12 0.53
13 0.48
14 0.47
15 0.42
16 0.47
17 0.47
18 0.47
19 0.42
20 0.44
21 0.5
22 0.55
23 0.53
24 0.47
25 0.43
26 0.43
27 0.42
28 0.41
29 0.37
30 0.3
31 0.29
32 0.27
33 0.27
34 0.24
35 0.22
36 0.18
37 0.14
38 0.12
39 0.13
40 0.14
41 0.12
42 0.12
43 0.11
44 0.11
45 0.09
46 0.09
47 0.08
48 0.07
49 0.07
50 0.07
51 0.06
52 0.05
53 0.05
54 0.05
55 0.05
56 0.05
57 0.05
58 0.06
59 0.07
60 0.08
61 0.08
62 0.09
63 0.09
64 0.1
65 0.12
66 0.11
67 0.11
68 0.11
69 0.11
70 0.13
71 0.15
72 0.14
73 0.12
74 0.12
75 0.13
76 0.16
77 0.18
78 0.18
79 0.18
80 0.19
81 0.23
82 0.27
83 0.26
84 0.24
85 0.26
86 0.28
87 0.28
88 0.28
89 0.25
90 0.23
91 0.22
92 0.21
93 0.17
94 0.12
95 0.09
96 0.08
97 0.08
98 0.05
99 0.05
100 0.04
101 0.04
102 0.04
103 0.05
104 0.05
105 0.05
106 0.05
107 0.04
108 0.05
109 0.05
110 0.05
111 0.05
112 0.05
113 0.05
114 0.06
115 0.07
116 0.07
117 0.08
118 0.08
119 0.09
120 0.12
121 0.12
122 0.12
123 0.13
124 0.18
125 0.19
126 0.2
127 0.24
128 0.22
129 0.21
130 0.2
131 0.24
132 0.24
133 0.27
134 0.36
135 0.35
136 0.36
137 0.38
138 0.4
139 0.4
140 0.37
141 0.34
142 0.27
143 0.23
144 0.25
145 0.26
146 0.25
147 0.2
148 0.18
149 0.16
150 0.18
151 0.18
152 0.15
153 0.14
154 0.2
155 0.21
156 0.25
157 0.24
158 0.22
159 0.22
160 0.21
161 0.19
162 0.14
163 0.15
164 0.1
165 0.12
166 0.11
167 0.15
168 0.16
169 0.17
170 0.18
171 0.15
172 0.15
173 0.12
174 0.12
175 0.07
176 0.07
177 0.05
178 0.04
179 0.04
180 0.04
181 0.04
182 0.04
183 0.04
184 0.04
185 0.04
186 0.04
187 0.04
188 0.05
189 0.07
190 0.09
191 0.11
192 0.14
193 0.18
194 0.22
195 0.24
196 0.26
197 0.28
198 0.29
199 0.28
200 0.27
201 0.27
202 0.26
203 0.26
204 0.23
205 0.2
206 0.17
207 0.15
208 0.13
209 0.1
210 0.07
211 0.05
212 0.06
213 0.05
214 0.05
215 0.07
216 0.07
217 0.07
218 0.08
219 0.08
220 0.07
221 0.08
222 0.08
223 0.07
224 0.07
225 0.08
226 0.07
227 0.07
228 0.08
229 0.08
230 0.08
231 0.08
232 0.08
233 0.1
234 0.12
235 0.13
236 0.13
237 0.12
238 0.13
239 0.16
240 0.17
241 0.19
242 0.24
243 0.31
244 0.33
245 0.38
246 0.35
247 0.36
248 0.4
249 0.42
250 0.34
251 0.27
252 0.29
253 0.26
254 0.26
255 0.23
256 0.18
257 0.13
258 0.13
259 0.12
260 0.08
261 0.07
262 0.07
263 0.06
264 0.07
265 0.06
266 0.06
267 0.07
268 0.07
269 0.08
270 0.09
271 0.09
272 0.08
273 0.08
274 0.08
275 0.09
276 0.09
277 0.09
278 0.09
279 0.1
280 0.13
281 0.14
282 0.14
283 0.15
284 0.17
285 0.18
286 0.18
287 0.18
288 0.18
289 0.2
290 0.19
291 0.17
292 0.14
293 0.12
294 0.11
295 0.11
296 0.09
297 0.06
298 0.12
299 0.12
300 0.14
301 0.16
302 0.16
303 0.19
304 0.23
305 0.23
306 0.18
307 0.18
308 0.17
309 0.17
310 0.16
311 0.13
312 0.09
313 0.1
314 0.09
315 0.12
316 0.12
317 0.1
318 0.1
319 0.09
320 0.09
321 0.08
322 0.07
323 0.04
324 0.04
325 0.04
326 0.04
327 0.04
328 0.06
329 0.07
330 0.08
331 0.1
332 0.1
333 0.1
334 0.13
335 0.17
336 0.22
337 0.31
338 0.34
339 0.38
340 0.38
341 0.38
342 0.39
343 0.37
344 0.33
345 0.26
346 0.25
347 0.23
348 0.25
349 0.25
350 0.24
351 0.3
352 0.35
353 0.42
354 0.47
355 0.54
356 0.62
357 0.71
358 0.8
359 0.83
360 0.84
361 0.85
362 0.89
363 0.9
364 0.88
365 0.81
366 0.76
367 0.68
368 0.59
369 0.48
370 0.38
371 0.32
372 0.24
373 0.23
374 0.17
375 0.15
376 0.18
377 0.19
378 0.18
379 0.13
380 0.12
381 0.11
382 0.11
383 0.11
384 0.08
385 0.08
386 0.08
387 0.09
388 0.11
389 0.1
390 0.09
391 0.13
392 0.15
393 0.16
394 0.18
395 0.19
396 0.19
397 0.24
398 0.26
399 0.23
400 0.27
401 0.27
402 0.29
403 0.36
404 0.39
405 0.37
406 0.39
407 0.4
408 0.4
409 0.41
410 0.4
411 0.37
412 0.38
413 0.42
414 0.43
415 0.46
416 0.42
417 0.46
418 0.43
419 0.39
420 0.38
421 0.31
422 0.3
423 0.32
424 0.35
425 0.33
426 0.39
427 0.38
428 0.35
429 0.38
430 0.41
431 0.37
432 0.34
433 0.3
434 0.25
435 0.26
436 0.26
437 0.23
438 0.18
439 0.16
440 0.14
441 0.12
442 0.1
443 0.08
444 0.07
445 0.07
446 0.05
447 0.06
448 0.05
449 0.04
450 0.05
451 0.06
452 0.06
453 0.05
454 0.06
455 0.06
456 0.06
457 0.06
458 0.06
459 0.05
460 0.05
461 0.05
462 0.05
463 0.06
464 0.05
465 0.05
466 0.04