Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A125PIH8

Protein Details
Accession A0A125PIH8    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
35-58YDCLWCNKRFSRRHDRARHCVTVHHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 12.666, mito 12, nucl 11, cyto_nucl 8.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Pfam View protein in Pfam  
PF00096  zf-C2H2  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences SSRRFTCPHPGCGRGFARNFNMQSHYKSHLGVREYDCLWCNKRFSRRHDRARHCVTVH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.49
3 0.44
4 0.43
5 0.45
6 0.44
7 0.38
8 0.39
9 0.34
10 0.34
11 0.33
12 0.32
13 0.26
14 0.26
15 0.26
16 0.25
17 0.24
18 0.26
19 0.24
20 0.24
21 0.23
22 0.24
23 0.24
24 0.24
25 0.27
26 0.26
27 0.28
28 0.32
29 0.41
30 0.47
31 0.55
32 0.62
33 0.69
34 0.77
35 0.83
36 0.85
37 0.86
38 0.87