Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A109FMB2

Protein Details
Accession A0A109FMB2    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
24-49QSKGGAAKKKKWSKGKVKDKANNAVVHydrophilic
NLS Segment(s)
PositionSequence
25-43SKGGAAKKKKWSKGKVKDK
Subcellular Location(s) cyto 13.5, cyto_nucl 9.5, mito 8, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MGLHGGSASLAGGDEAKAAGAAAQSKGGAAKKKKWSKGKVKDKANNAVVCDKPTFDRIMKEVPTFKMISQSVLIERMKINGSLARVAIQHLHKEGLIKPVIHHRAQLVYTRATAEADA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.04
5 0.04
6 0.05
7 0.05
8 0.07
9 0.07
10 0.08
11 0.08
12 0.08
13 0.11
14 0.14
15 0.21
16 0.25
17 0.33
18 0.43
19 0.52
20 0.61
21 0.68
22 0.75
23 0.78
24 0.84
25 0.87
26 0.86
27 0.87
28 0.85
29 0.82
30 0.81
31 0.76
32 0.66
33 0.57
34 0.53
35 0.43
36 0.38
37 0.32
38 0.24
39 0.19
40 0.18
41 0.19
42 0.14
43 0.15
44 0.15
45 0.19
46 0.2
47 0.2
48 0.22
49 0.2
50 0.22
51 0.21
52 0.19
53 0.21
54 0.2
55 0.19
56 0.17
57 0.17
58 0.15
59 0.19
60 0.19
61 0.14
62 0.14
63 0.14
64 0.14
65 0.13
66 0.14
67 0.12
68 0.13
69 0.13
70 0.13
71 0.13
72 0.12
73 0.13
74 0.17
75 0.17
76 0.18
77 0.18
78 0.19
79 0.18
80 0.2
81 0.22
82 0.23
83 0.24
84 0.22
85 0.22
86 0.32
87 0.37
88 0.35
89 0.35
90 0.31
91 0.32
92 0.34
93 0.38
94 0.32
95 0.29
96 0.29
97 0.29
98 0.27